"TOX4" Related Products

Recombinant Human TOX4 protein, T7/His-tagged

Cat.No.: TOX4-104H
Product Overview: Recombinant human TOX4 (620 aa, Isoform-I) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.20 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFEFPGGNDNYLTITGPSHPFLSGAETFHTPSLGDEEFEIPPISLDSD PSLAVSDVVGHFDDLADPSSSQDGSFSAQYGVQTLDMPVGMTHGLMEQGGGLLSGGLTMDLDHSIGTQYSANPPV TIDVPMTDMTSGLMGHSQLTTIDQSELSSQLGLSLGGGTILPPAQSPEDRLSTTPSPTSSLHEDGVEDFRRQLPS QKTVVVEAGKKQKAPKKRKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVY KRKTEAAKKEYLKALAAYKDNQECQATVETVELDPAPPSQTPSPPPMATVDPASPAPASIEPPALSPSIVVNSTL SSYVANQASSGAGGQPNITKLIITKQMLPSSITMSQGGMVTVIPATVVTSRGLQLGQTSTATIQPSQQAQIVTRS VLQAAAAAAAAASMQLPPPRLQPPPLQQMPQPPTQQQVTILQQPPPLQAMQQPPPQKVRINLQQQPPPLQIKSVP LPTLKMQTTLVPPTVESSPERPMNNSPEAHTVEAPSPETICEMITDVVPEVESPSQMDVELVSGSPVALSPQPRC VRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVASRNSNTVVFVK
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro TOX4 mediated histone methylations / chromosomal structure regulation study for various cells with "ProFectin" reagent based intracellular delivery of this protein.2. May be used as specific protein substrate for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. May be used for TOX4 protein-protein interaction mapping.4. As immunogen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: TOX4 TOX high mobility group box family member 4 [ Homo sapiens ]
Official Symbol: TOX4
Synonyms: TOX4; TOX high mobility group box family member 4; C14orf92, chromosome 14 open reading frame 92 , KIAA0737; LCP1; migration-inducing protein 7; epidermal Langerhans cell protein LCP1; MIG7; C14orf92; KIAA0737;
Gene ID: 9878
mRNA Refseq: NM_014828
Protein Refseq: NP_055643
MIM: 614032
UniProt ID: O94842
Chromosome Location: 14q11.2
Function: DNA binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.