Recombinant Human TOX4 protein, GST-tagged
Cat.No. : | TOX4-301548H |
Product Overview : | Recombinant Human TOX4 (43-215 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ser43-Arg215 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | SLDSDPSLAVSDVVGHFDDLADPSSSQDGSFSAQYGVQTLDMPVGMTHGLMEQGGGLLSGGLTMDLDHSIGTQYSANPPVTIDVPMTDMTSGLMGHSQLTTIDQSELSSQLGLSLGGGTILPPAQSPEDRLSTTPSPTSSLHEDGVEDFRRQLPSQKTVVVEAGKKQKAPKKR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | TOX4 TOX high mobility group box family member 4 [ Homo sapiens ] |
Official Symbol | TOX4 |
Synonyms | TOX4; TOX high mobility group box family member 4; C14orf92, chromosome 14 open reading frame 92 , KIAA0737; LCP1; migration-inducing protein 7; epidermal Langerhans cell protein LCP1; MIG7; C14orf92; KIAA0737; |
Gene ID | 9878 |
mRNA Refseq | NM_014828 |
Protein Refseq | NP_055643 |
MIM | 614032 |
UniProt ID | O94842 |
◆ Recombinant Proteins | ||
TOX4-4723R | Recombinant Rhesus Macaque TOX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
TOX4-104H | Recombinant Human TOX4 protein, T7/His-tagged | +Inquiry |
TOX4-4909R | Recombinant Rhesus monkey TOX4 Protein, His-tagged | +Inquiry |
TOX4-301548H | Recombinant Human TOX4 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TOX4-861HCL | Recombinant Human TOX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TOX4 Products
Required fields are marked with *
My Review for All TOX4 Products
Required fields are marked with *
0
Inquiry Basket