Recombinant Human TOX4 protein, GST-tagged

Cat.No. : TOX4-301548H
Product Overview : Recombinant Human TOX4 (43-215 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Ser43-Arg215
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : SLDSDPSLAVSDVVGHFDDLADPSSSQDGSFSAQYGVQTLDMPVGMTHGLMEQGGGLLSGGLTMDLDHSIGTQYSANPPVTIDVPMTDMTSGLMGHSQLTTIDQSELSSQLGLSLGGGTILPPAQSPEDRLSTTPSPTSSLHEDGVEDFRRQLPSQKTVVVEAGKKQKAPKKR
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name TOX4 TOX high mobility group box family member 4 [ Homo sapiens ]
Official Symbol TOX4
Synonyms TOX4; TOX high mobility group box family member 4; C14orf92, chromosome 14 open reading frame 92 , KIAA0737; LCP1; migration-inducing protein 7; epidermal Langerhans cell protein LCP1; MIG7; C14orf92; KIAA0737;
Gene ID 9878
mRNA Refseq NM_014828
Protein Refseq NP_055643
MIM 614032
UniProt ID O94842

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TOX4 Products

Required fields are marked with *

My Review for All TOX4 Products

Required fields are marked with *

0
cart-icon