Recombinant Human TOX4 protein, T7/His-tagged
Cat.No. : | TOX4-104H |
Product Overview : | Recombinant human TOX4 (620 aa, Isoform-I) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 620 a.a. |
Form : | 0.20 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFEFPGGNDNYLTITGPSHPFLSGAETFHTPSLGDEEFEIPPISLDSD PSLAVSDVVGHFDDLADPSSSQDGSFSAQYGVQTLDMPVGMTHGLMEQGGGLLSGGLTMDLDHSIGTQYSANPPV TIDVPMTDMTSGLMGHSQLTTIDQSELSSQLGLSLGGGTILPPAQSPEDRLSTTPSPTSSLHEDGVEDFRRQLPS QKTVVVEAGKKQKAPKKRKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVY KRKTEAAKKEYLKALAAYKDNQECQATVETVELDPAPPSQTPSPPPMATVDPASPAPASIEPPALSPSIVVNSTL SSYVANQASSGAGGQPNITKLIITKQMLPSSITMSQGGMVTVIPATVVTSRGLQLGQTSTATIQPSQQAQIVTRS VLQAAAAAAAAASMQLPPPRLQPPPLQQMPQPPTQQQVTILQQPPPLQAMQQPPPQKVRINLQQQPPPLQIKSVP LPTLKMQTTLVPPTVESSPERPMNNSPEAHTVEAPSPETICEMITDVVPEVESPSQMDVELVSGSPVALSPQPRC VRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVASRNSNTVVFVK |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro TOX4 mediated histone methylations / chromosomal structure regulation study for various cells with "ProFectin" reagent based intracellular delivery of this protein.2. May be used as specific protein substrate for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. May be used for TOX4 protein-protein interaction mapping.4. As immunogen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | TOX4 TOX high mobility group box family member 4 [ Homo sapiens ] |
Official Symbol | TOX4 |
Synonyms | TOX4; TOX high mobility group box family member 4; C14orf92, chromosome 14 open reading frame 92 , KIAA0737; LCP1; migration-inducing protein 7; epidermal Langerhans cell protein LCP1; MIG7; C14orf92; KIAA0737; |
Gene ID | 9878 |
mRNA Refseq | NM_014828 |
Protein Refseq | NP_055643 |
MIM | 614032 |
UniProt ID | O94842 |
Chromosome Location | 14q11.2 |
Function | DNA binding; protein binding; |
◆ Recombinant Proteins | ||
TOX4-301548H | Recombinant Human TOX4 protein, GST-tagged | +Inquiry |
TOX4-4723R | Recombinant Rhesus Macaque TOX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
TOX4-4909R | Recombinant Rhesus monkey TOX4 Protein, His-tagged | +Inquiry |
TOX4-104H | Recombinant Human TOX4 protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TOX4-861HCL | Recombinant Human TOX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TOX4 Products
Required fields are marked with *
My Review for All TOX4 Products
Required fields are marked with *
0
Inquiry Basket