Recombinant Human TP53 protein(101-310 aa), N-MBP & C-His-tagged
Cat.No. : | TP53-2548H |
Product Overview : | Recombinant Human TP53 protein(P04637)(101-310 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His&MBP |
Protein Length : | 101-310 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 67 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPN |
Gene Name | TP53 tumor protein p53 [ Homo sapiens ] |
Official Symbol | TP53 |
Synonyms | TP53; tumor protein p53; cellular tumor antigen p53; LFS1; Li Fraumeni syndrome; p53; antigen NY-CO-13; mutant p53 protein; phosphoprotein p53; p53 tumor suppressor; truncated p53 protein; tumor suppressor TP53; transformation-related protein 53; P53; TRP53; FLJ92943; |
Gene ID | 7157 |
mRNA Refseq | NM_000546 |
Protein Refseq | NP_000537 |
MIM | 191170 |
UniProt ID | P04637 |
◆ Recombinant Proteins | ||
TP53-170H | Active Recombinant Human Tumor Protein P53 | +Inquiry |
TP53-6496H | Recombinant Human TP53 Protein, His-tagged | +Inquiry |
TP53-4922H | Recombinant Human TP53 protein(1-393aa(R273H)), His-tagged | +Inquiry |
TP53-3412H | Active Recombinant Human TP53, His-tagged | +Inquiry |
TP53-30547TH | Recombinant Human TP53, GST-tagged | +Inquiry |
◆ Native Proteins | ||
TP53-01HFL | Active Recombinant Full Length Human TP53 Protein, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TP53-860HCL | Recombinant Human TP53 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TP53 Products
Required fields are marked with *
My Review for All TP53 Products
Required fields are marked with *