Recombinant Human TP53 protein(101-310 aa), N-MBP & C-His-tagged
| Cat.No. : | TP53-2548H |
| Product Overview : | Recombinant Human TP53 protein(P04637)(101-310 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His&MBP |
| Protein Length : | 101-310 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 67 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | KTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPN |
| Gene Name | TP53 tumor protein p53 [ Homo sapiens ] |
| Official Symbol | TP53 |
| Synonyms | TP53; tumor protein p53; cellular tumor antigen p53; LFS1; Li Fraumeni syndrome; p53; antigen NY-CO-13; mutant p53 protein; phosphoprotein p53; p53 tumor suppressor; truncated p53 protein; tumor suppressor TP53; transformation-related protein 53; P53; TRP53; FLJ92943; |
| Gene ID | 7157 |
| mRNA Refseq | NM_000546 |
| Protein Refseq | NP_000537 |
| MIM | 191170 |
| UniProt ID | P04637 |
| ◆ Recombinant Proteins | ||
| TP53-30574H | Recombinant Human TP53 Protein, GST-tagged | +Inquiry |
| TP53-5887R | Recombinant Rat TP53 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TP53-1162CAF555 | Active Recombinant Cynomolgus TP53 Protein, Alexa Fluor 555 conjugated | +Inquiry |
| TP53-5633H | Recombinant Human TP53 protein, His-tagged | +Inquiry |
| TP53-1044C | Recombinant Cynomolgus TP53 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TP53-860HCL | Recombinant Human TP53 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TP53 Products
Required fields are marked with *
My Review for All TP53 Products
Required fields are marked with *
