Recombinant Human TP53INP1 protein, His-tagged
Cat.No. : | TP53INP1-7854H |
Product Overview : | Recombinant Human TP53INP1 protein(1-240 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-240 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEATRGTDELHSPSSPRVEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQYNY |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | TP53INP1 tumor protein p53 inducible nuclear protein 1 [ Homo sapiens ] |
Official Symbol | TP53INP1 |
Synonyms | TP53INP1; tumor protein p53 inducible nuclear protein 1; tumor protein p53-inducible nuclear protein 1; DKFZp434M1317; FLJ22139; P53DINP1; SIP; Teap; TP53INP1A; TP53INP1B; p53-inducible p53DINP1; stress-induced protein; p53-dependent damage-inducible nuclear protein 1; p53DINP1; TP53DINP1; |
Gene ID | 94241 |
mRNA Refseq | NM_001135733 |
Protein Refseq | NP_001129205 |
MIM | 606185 |
UniProt ID | Q96A56 |
◆ Recombinant Proteins | ||
TP53INP1-6233R | Recombinant Rat TP53INP1 Protein | +Inquiry |
TP53INP1-7854H | Recombinant Human TP53INP1 protein, His-tagged | +Inquiry |
TP53INP1-3364H | Recombinant Human TP53INP1, GST-tagged | +Inquiry |
TP53INP1-4726R | Recombinant Rhesus Macaque TP53INP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TP53INP1-2635C | Recombinant Chicken TP53INP1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TP53INP1 Products
Required fields are marked with *
My Review for All TP53INP1 Products
Required fields are marked with *