Recombinant Human TP53INP1 protein, His-tagged

• Cat.No.: TP53INP1-7854H
• Product Overview: Recombinant Human TP53INP1 protein(1-240 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-240 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEATRGTDELHSPSSPRVEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQYNY
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: TP53INP1 tumor protein p53 inducible nuclear protein 1 [ Homo sapiens ]
• Official Symbol: TP53INP1
• Synonyms: TP53INP1; tumor protein p53 inducible nuclear protein 1; tumor protein p53-inducible nuclear protein 1; DKFZp434M1317; FLJ22139; P53DINP1; SIP; Teap; TP53INP1A; TP53INP1B; p53-inducible p53DINP1; stress-induced protein; p53-dependent damage-inducible nuclear protein 1; p53DINP1; TP53DINP1
• Gene ID: 94241
• mRNA Refseq: NM_001135733
• Protein Refseq: NP_001129205
• MIM: 606185
• UniProt ID: Q96A56