Recombinant Human TP73 protein(261-350 aa), C-His-tagged

• Cat.No.: TP73-2463H
• Product Overview: Recombinant Human TP73 protein(O15350)(261-350 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 261-350 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: SCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRHG

Gene Information

• Gene Name: TP73 tumor protein p73 [ Homo sapiens ]
• Official Symbol: TP73
• Synonyms: TP73; tumor protein p73; P73; p53-related protein; p53-like transcription factor
• Gene ID: 7161
• mRNA Refseq: NM_001126240
• Protein Refseq: NP_001119712
• MIM: 601990
• UniProt ID: O15350