Recombinant Human TP73 protein(261-350 aa), C-His-tagged

Cat.No. : TP73-2463H
Product Overview : Recombinant Human TP73 protein(O15350)(261-350 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 261-350 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : SCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRHG
Gene Name TP73 tumor protein p73 [ Homo sapiens ]
Official Symbol TP73
Synonyms TP73; tumor protein p73; P73; p53-related protein; p53-like transcription factor;
Gene ID 7161
mRNA Refseq NM_001126240
Protein Refseq NP_001119712
MIM 601990
UniProt ID O15350

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TP73 Products

Required fields are marked with *

My Review for All TP73 Products

Required fields are marked with *

0
cart-icon