Recombinant Human TPD52 Protein (1-184 aa), His-SUMO-tagged
Cat.No. : | TPD52-839H |
Product Overview : | Recombinant Human TPD52 Protein (1-184 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length of Isoform 2. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-184 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 35.9 kDa |
AA Sequence : | MDRGEQGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | TPD52 tumor protein D52 [ Homo sapiens ] |
Official Symbol | TPD52 |
Synonyms | TPD52; D52; hD52; N8L; protein N8; PC-1; PrLZ; |
Gene ID | 7163 |
mRNA Refseq | NM_001025252 |
Protein Refseq | NP_001020423 |
MIM | 604068 |
UniProt ID | P55327 |
◆ Recombinant Proteins | ||
TPD52-3586C | Recombinant Chicken TPD52 | +Inquiry |
TPD52-4916R | Recombinant Rhesus monkey TPD52 Protein, His-tagged | +Inquiry |
TPD52-170H | Recombinant Human TPD52 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Tpd52-6591M | Recombinant Mouse Tpd52 Protein, Myc/DDK-tagged | +Inquiry |
TPD52-4730R | Recombinant Rhesus Macaque TPD52 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPD52-850HCL | Recombinant Human TPD52 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPD52 Products
Required fields are marked with *
My Review for All TPD52 Products
Required fields are marked with *
0
Inquiry Basket