Recombinant Human TPD52 Protein (1-184 aa), His-SUMO-tagged

• Cat.No.: TPD52-839H
• Product Overview: Recombinant Human TPD52 Protein (1-184 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length of Isoform 2.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-184 aa
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 35.9 kDa
• AA Sequence: MDRGEQGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: TPD52 tumor protein D52 [ Homo sapiens ]
• Official Symbol: TPD52
• Synonyms: TPD52; D52; hD52; N8L; protein N8; PC-1; PrLZ
• Gene ID: 7163
• mRNA Refseq: NM_001025252
• Protein Refseq: NP_001020423
• MIM: 604068
• UniProt ID: P55327