Recombinant Human TPD52 Protein (1-184 aa), His-SUMO-tagged

Cat.No. : TPD52-839H
Product Overview : Recombinant Human TPD52 Protein (1-184 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length of Isoform 2.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-184 aa
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 35.9 kDa
AA Sequence : MDRGEQGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name TPD52 tumor protein D52 [ Homo sapiens ]
Official Symbol TPD52
Synonyms TPD52; D52; hD52; N8L; protein N8; PC-1; PrLZ;
Gene ID 7163
mRNA Refseq NM_001025252
Protein Refseq NP_001020423
MIM 604068
UniProt ID P55327

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TPD52 Products

Required fields are marked with *

My Review for All TPD52 Products

Required fields are marked with *

0
cart-icon
0
compare icon