Recombinant Human TPD52L1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TPD52L1-2086H |
Product Overview : | TPD52L1 MS Standard C13 and N15-labeled recombinant protein (NP_001003396) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of a family of proteins that contain coiled-coil domains and may form hetero- or homomers. The encoded protein is involved in cell proliferation and calcium signaling. It also interacts with the mitogen-activated protein kinase kinase kinase 5 (MAP3K5/ASK1) and positively regulates MAP3K5-induced apoptosis. Multiple alternatively spliced transcript variants have been observed. |
Molecular Mass : | 16.2 kDa |
AA Sequence : | MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRRKSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TPD52L1 tumor protein D52-like 1 [ Homo sapiens (human) ] |
Official Symbol | TPD52L1 |
Synonyms | TPD52L1; tumor protein D52-like 1; tumor protein D53; D53; hD53; MGC8556; |
Gene ID | 7164 |
mRNA Refseq | NM_001003396 |
Protein Refseq | NP_001003396 |
MIM | 604069 |
UniProt ID | Q16890 |
◆ Recombinant Proteins | ||
TPD52L1-4917R | Recombinant Rhesus monkey TPD52L1 Protein, His-tagged | +Inquiry |
TPD52L1-13702H | Recombinant Human TPD52L1, GST-tagged | +Inquiry |
TPD52L1-5789C | Recombinant Chicken TPD52L1 | +Inquiry |
TPD52L1-2279H | Recombinant Human TPD52L1 Protein, MYC/DDK-tagged | +Inquiry |
TPD52L1-9531M | Recombinant Mouse TPD52L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPD52L1-1813HCL | Recombinant Human TPD52L1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPD52L1 Products
Required fields are marked with *
My Review for All TPD52L1 Products
Required fields are marked with *