Recombinant Human TPD52L1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TPD52L1-2086H
Product Overview : TPD52L1 MS Standard C13 and N15-labeled recombinant protein (NP_001003396) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of a family of proteins that contain coiled-coil domains and may form hetero- or homomers. The encoded protein is involved in cell proliferation and calcium signaling. It also interacts with the mitogen-activated protein kinase kinase kinase 5 (MAP3K5/ASK1) and positively regulates MAP3K5-induced apoptosis. Multiple alternatively spliced transcript variants have been observed.
Molecular Mass : 16.2 kDa
AA Sequence : MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRRKSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TPD52L1 tumor protein D52-like 1 [ Homo sapiens (human) ]
Official Symbol TPD52L1
Synonyms TPD52L1; tumor protein D52-like 1; tumor protein D53; D53; hD53; MGC8556;
Gene ID 7164
mRNA Refseq NM_001003396
Protein Refseq NP_001003396
MIM 604069
UniProt ID Q16890

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TPD52L1 Products

Required fields are marked with *

My Review for All TPD52L1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon