Recombinant Human TPMT Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TPMT-5121H |
Product Overview : | TPMT MS Standard C13 and N15-labeled recombinant protein (NP_000358) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes the enzyme that metabolizes thiopurine drugs via S-adenosyl-L-methionine as the S-methyl donor and S-adenosyl-L-homocysteine as a byproduct. Thiopurine drugs such as 6-mercaptopurine are used as chemotherapeutic agents. Genetic polymorphisms that affect this enzymatic activity are correlated with variations in sensitivity and toxicity to such drugs within individuals, causing thiopurine S-methyltransferase deficiency. Related pseudogenes have been identified on chromosomes 3, 18 and X. |
Molecular Mass : | 28.2 kDa |
AA Sequence : | MDGTRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGKICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTEKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TPMT thiopurine S-methyltransferase [ Homo sapiens (human) ] |
Official Symbol | TPMT |
Synonyms | TPMT; thiopurine S-methyltransferase; S-adenosyl-L-methionine:thiopurine S-methyltransferase; |
Gene ID | 7172 |
mRNA Refseq | NM_000367 |
Protein Refseq | NP_000358 |
MIM | 187680 |
UniProt ID | P51580 |
◆ Recombinant Proteins | ||
TPMT-30640TH | Recombinant Human TPMT | +Inquiry |
TPMT-9540M | Recombinant Mouse TPMT Protein, His (Fc)-Avi-tagged | +Inquiry |
TPMT-76H | Recombinant Full Length Human Thiopurine S-methyltransferase/TPMT | +Inquiry |
TPMT-3612H | Recombinant Human TPMT protein, GST-tagged | +Inquiry |
TPMT-6503H | Recombinant Human TPMT Protein (Leu26-His227), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPMT-841HCL | Recombinant Human TPMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPMT Products
Required fields are marked with *
My Review for All TPMT Products
Required fields are marked with *