Recombinant Human TPPP protein, GST-tagged

Cat.No. : TPPP-3613H
Product Overview : Recombinant Human TPPP protein(O94811)(1-219aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-219aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 50.7 kDa
AA Sequence : MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name TPPP tubulin polymerization promoting protein [ Homo sapiens ]
Official Symbol TPPP
Synonyms TPPP; tubulin polymerization promoting protein; tubulin polymerization-promoting protein; brain specific protein p25 alpha; p25; p25alpha; TPPP/p25; TPPP1; p25-alpha; 25 kDa brain-specific protein; glycogen synthase kinase 3 (GSK3) inhibitor p24; p24;
Gene ID 11076
mRNA Refseq NM_007030
Protein Refseq NP_008961
MIM 608773
UniProt ID O94811

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TPPP Products

Required fields are marked with *

My Review for All TPPP Products

Required fields are marked with *

0
cart-icon
0
compare icon