Recombinant Human TPPP protein, GST-tagged
Cat.No. : | TPPP-3613H |
Product Overview : | Recombinant Human TPPP protein(O94811)(1-219aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-219aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 50.7 kDa |
AA Sequence : | MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TPPP tubulin polymerization promoting protein [ Homo sapiens ] |
Official Symbol | TPPP |
Synonyms | TPPP; tubulin polymerization promoting protein; tubulin polymerization-promoting protein; brain specific protein p25 alpha; p25; p25alpha; TPPP/p25; TPPP1; p25-alpha; 25 kDa brain-specific protein; glycogen synthase kinase 3 (GSK3) inhibitor p24; p24; |
Gene ID | 11076 |
mRNA Refseq | NM_007030 |
Protein Refseq | NP_008961 |
MIM | 608773 |
UniProt ID | O94811 |
◆ Recombinant Proteins | ||
Tppp-477M | Recombinant Mouse Tppp Protein, His-tagged | +Inquiry |
TPPP-2758H | Recombinant Human TPPP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TPPP-3613H | Recombinant Human TPPP protein, GST-tagged | +Inquiry |
TPPP-5709H | Recombinant Human TPPP protein, His & T7-tagged | +Inquiry |
TPPP-1506HFL | Recombinant Full Length Human TPPP Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPPP-839HCL | Recombinant Human TPPP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TPPP Products
Required fields are marked with *
My Review for All TPPP Products
Required fields are marked with *
0
Inquiry Basket