Recombinant Human TPPP protein, GST-tagged
| Cat.No. : | TPPP-3613H |
| Product Overview : | Recombinant Human TPPP protein(O94811)(1-219aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-219aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 50.7 kDa |
| AA Sequence : | MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | TPPP tubulin polymerization promoting protein [ Homo sapiens ] |
| Official Symbol | TPPP |
| Synonyms | TPPP; tubulin polymerization promoting protein; tubulin polymerization-promoting protein; brain specific protein p25 alpha; p25; p25alpha; TPPP/p25; TPPP1; p25-alpha; 25 kDa brain-specific protein; glycogen synthase kinase 3 (GSK3) inhibitor p24; p24; |
| Gene ID | 11076 |
| mRNA Refseq | NM_007030 |
| Protein Refseq | NP_008961 |
| MIM | 608773 |
| UniProt ID | O94811 |
| ◆ Recombinant Proteins | ||
| TPPP-2758H | Recombinant Human TPPP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TPPP-3373H | Recombinant Human TPPP protein, His-tagged | +Inquiry |
| TPPP-4920R | Recombinant Rhesus monkey TPPP Protein, His-tagged | +Inquiry |
| Tppp-6605M | Recombinant Mouse Tppp Protein, Myc/DDK-tagged | +Inquiry |
| TPPP-5588H | Recombinant Human TPPP Protein (Ala8-Thr210), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TPPP-839HCL | Recombinant Human TPPP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPPP Products
Required fields are marked with *
My Review for All TPPP Products
Required fields are marked with *




