Recombinant Human TPRKB Protein, GST-Tagged
Cat.No. : | TPRKB-1333H |
Product Overview : | Human TPRKB full-length ORF (NP_057142.1, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | TPRKB (TP53RK Binding Protein) is a Protein Coding gene. Among its related pathways are Gene Expression and tRNA processing. GO annotations related to this gene include protein kinase binding. |
Molecular Mass : | 46.1 kDa |
AA Sequence : | MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TPRKB TP53RK binding protein [ Homo sapiens ] |
Official Symbol | TPRKB |
Synonyms | TPRKB; TP53RK binding protein; TP53RK-binding protein; CGI 121; PRPK-binding protein; PRPK (p53-related protein kinase)-binding protein; CGI-121; |
Gene ID | 51002 |
mRNA Refseq | NM_016058 |
Protein Refseq | NP_057142 |
MIM | 608680 |
UniProt ID | Q9Y3C4 |
◆ Recombinant Proteins | ||
TPRKB-3377H | Recombinant Human TPRKB, His-tagged | +Inquiry |
TPRKB-3550HF | Recombinant Full Length Human TPRKB Protein, GST-tagged | +Inquiry |
TPRKB-17270M | Recombinant Mouse TPRKB Protein | +Inquiry |
Tprkb-6610M | Recombinant Mouse Tprkb Protein, Myc/DDK-tagged | +Inquiry |
TPRKB-9549M | Recombinant Mouse TPRKB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPRKB-836HCL | Recombinant Human TPRKB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPRKB Products
Required fields are marked with *
My Review for All TPRKB Products
Required fields are marked with *