Recombinant Human TPSG1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TPSG1-6642H |
Product Overview : | TPSG1 MS Standard C13 and N15-labeled recombinant protein (NP_036599) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. There is uncertainty regarding the number of genes in this cluster. Currently four functional genes - alpha I, beta I, beta II and gamma I - have been identified. And beta I has an allelic variant named alpha II, beta II has an allelic variant beta III, also gamma I has an allelic variant gamma II. Beta tryptases appear to be the main isoenzymes expressed in mast cells; whereas in basophils, alpha-tryptases predominant. This gene differs from other members of the tryptase gene family in that it has C-terminal hydrophobic domain, which may serve as a membrane anchor. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders. |
Molecular Mass : | 33.76 kDa |
AA Sequence : | MALGACGLLLLLAVPGVSLRTLQPGCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRRMHVCGGSLLSPQWVLTAAHCFSGSLNSSDYQVHLGELEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSRILPVCLPEASDDFCPGIRCSVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCARGPGDACQDDSGGPLVCQVNGAWVQAGIVSWGEGCGRPNRPGVYTRVPAYVNWIRRHITASGGSESGYPRLPLLAGFFLPGLFLLLVSCVLLAKCLLHPSADGTPFPAPDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TPSG1 tryptase gamma 1 [ Homo sapiens (human) ] |
Official Symbol | TPSG1 |
Synonyms | TPSG1; tryptase gamma 1; tryptase gamma; PRSS31; TMT; tryptase gamma I; tryptase gamma II; gamma I; gamma II; lung tryptase; skin tryptase; mast cell tryptase; pituitary tryptase; serine protease 31; mast cell protease II; transmembrane tryptase; trpA; |
Gene ID | 25823 |
mRNA Refseq | NM_012467 |
Protein Refseq | NP_036599 |
MIM | 609341 |
UniProt ID | Q9NRR2 |
◆ Recombinant Proteins | ||
TPSG1-4925R | Recombinant Rhesus monkey TPSG1 Protein, His-tagged | +Inquiry |
TPSG1-6642H | Recombinant Human TPSG1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL5934HF | Recombinant Full Length Human Tryptase Gamma(Tpsg1) Protein, His-Tagged | +Inquiry |
Tpsg1-6611M | Recombinant Mouse Tpsg1 Protein, Myc/DDK-tagged | +Inquiry |
RFL2721MF | Recombinant Full Length Mouse Tryptase Gamma(Tpsg1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPSG1-834HCL | Recombinant Human TPSG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TPSG1 Products
Required fields are marked with *
My Review for All TPSG1 Products
Required fields are marked with *
0
Inquiry Basket