Recombinant Human TPST2 protein, His-SUMO-tagged
Cat.No. : | TPST2-3616H |
Product Overview : | Recombinant Human TPST2 protein(O60704)(26-377aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 26-377aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 55.3 kDa |
AA Sequence : | QQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNSTSSHLGSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TPST2 tyrosylprotein sulfotransferase 2 [ Homo sapiens ] |
Official Symbol | TPST2 |
Synonyms | TPST2; tyrosylprotein sulfotransferase 2; protein-tyrosine sulfotransferase 2; TPST-2; tyrosylprotein sulfotransferase-2; tyrosylprotein phosphotransferase 2; |
Gene ID | 8459 |
mRNA Refseq | NM_001008566 |
Protein Refseq | NP_001008566 |
MIM | 603126 |
UniProt ID | O60704 |
◆ Recombinant Proteins | ||
TPST2-3380H | Recombinant Human TPST2, GST-tagged | +Inquiry |
TPST2-581H | Recombinant Human tyrosylprotein sulfotransferase 2, His-tagged | +Inquiry |
TPST2-10730Z | Recombinant Zebrafish TPST2 | +Inquiry |
TPST2-1006H | Active Recombinant Human TPST2 Protein, His-tagged | +Inquiry |
TPST2-3616H | Recombinant Human TPST2 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPST2-832HCL | Recombinant Human TPST2 293 Cell Lysate | +Inquiry |
TPST2-833HCL | Recombinant Human TPST2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPST2 Products
Required fields are marked with *
My Review for All TPST2 Products
Required fields are marked with *