Recombinant Human TPST2 protein, His-tagged
| Cat.No. : | TPST2-2939H |
| Product Overview : | Recombinant Human TPST2 protein(1-377 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-377 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MRLSVRRVLLAAGCALVLVLAVQLGQQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNSTSSHLGSS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TPST2 tyrosylprotein sulfotransferase 2 [ Homo sapiens ] |
| Official Symbol | TPST2 |
| Synonyms | TPST2; tyrosylprotein sulfotransferase 2; protein-tyrosine sulfotransferase 2; TPST-2; tyrosylprotein sulfotransferase-2; tyrosylprotein phosphotransferase 2; |
| Gene ID | 8459 |
| mRNA Refseq | NM_001008566 |
| Protein Refseq | NP_001008566 |
| MIM | 603126 |
| UniProt ID | O60704 |
| ◆ Recombinant Proteins | ||
| TPST2-581H | Recombinant Human tyrosylprotein sulfotransferase 2, His-tagged | +Inquiry |
| TPST2-2571H | Recombinant Human TPST2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RFL9789HF | Recombinant Full Length Human Protein-Tyrosine Sulfotransferase 2(Tpst2) Protein, His-Tagged | +Inquiry |
| TPST2-10730Z | Recombinant Zebrafish TPST2 | +Inquiry |
| TPST2-1006H | Active Recombinant Human TPST2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TPST2-832HCL | Recombinant Human TPST2 293 Cell Lysate | +Inquiry |
| TPST2-833HCL | Recombinant Human TPST2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPST2 Products
Required fields are marked with *
My Review for All TPST2 Products
Required fields are marked with *
