Recombinant Human TPST2 protein, His-tagged
Cat.No. : | TPST2-2939H |
Product Overview : | Recombinant Human TPST2 protein(1-377 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-377 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MRLSVRRVLLAAGCALVLVLAVQLGQQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNSTSSHLGSS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TPST2 tyrosylprotein sulfotransferase 2 [ Homo sapiens ] |
Official Symbol | TPST2 |
Synonyms | TPST2; tyrosylprotein sulfotransferase 2; protein-tyrosine sulfotransferase 2; TPST-2; tyrosylprotein sulfotransferase-2; tyrosylprotein phosphotransferase 2; |
Gene ID | 8459 |
mRNA Refseq | NM_001008566 |
Protein Refseq | NP_001008566 |
MIM | 603126 |
UniProt ID | O60704 |
◆ Recombinant Proteins | ||
TPST2-10730Z | Recombinant Zebrafish TPST2 | +Inquiry |
TPST2-6252R | Recombinant Rat TPST2 Protein | +Inquiry |
TPST2-3616H | Recombinant Human TPST2 protein, His-SUMO-tagged | +Inquiry |
TPST2-2571H | Recombinant Human TPST2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL9789HF | Recombinant Full Length Human Protein-Tyrosine Sulfotransferase 2(Tpst2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPST2-832HCL | Recombinant Human TPST2 293 Cell Lysate | +Inquiry |
TPST2-833HCL | Recombinant Human TPST2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TPST2 Products
Required fields are marked with *
My Review for All TPST2 Products
Required fields are marked with *
0
Inquiry Basket