Recombinant Full Length Human Protein-Tyrosine Sulfotransferase 2(Tpst2) Protein, His-Tagged
Cat.No. : | RFL9789HF |
Product Overview : | Recombinant Full Length Human Protein-tyrosine sulfotransferase 2(TPST2) Protein (O60704) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MRLSVRRVLLAAGCALVLVLAVQLGQQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNSTSSHLGSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TPST2 |
Synonyms | EC 2.8.2.20; Protein tyrosine sulfotransferase 2; Protein-tyrosine sulfotransferase 2; TANGO13B; TPST-2; Tpst2; TPST2_HUMAN; Transport and golgi organization 13 homolog B; Tyrosylprotein phosphotransferase 2; Tyrosylprotein sulfotransferase 2 |
UniProt ID | O60704 |
◆ Recombinant Proteins | ||
TPST2-10730Z | Recombinant Zebrafish TPST2 | +Inquiry |
TPST2-2571H | Recombinant Human TPST2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TPST2-5909R | Recombinant Rat TPST2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TPST2-1006H | Active Recombinant Human TPST2 Protein, His-tagged | +Inquiry |
TPST2-3380H | Recombinant Human TPST2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPST2-833HCL | Recombinant Human TPST2 293 Cell Lysate | +Inquiry |
TPST2-832HCL | Recombinant Human TPST2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPST2 Products
Required fields are marked with *
My Review for All TPST2 Products
Required fields are marked with *