Recombinant Human TPT1 protein, T7/His-tagged

Cat.No. : TPT1-214H
Product Overview : Recombinant human TPT1 cDNA (2 – 172 aa, Isoform-II, derived from BC003352) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 2-172 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, DTT and Sucrose.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSL IGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQI KHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name TPT1 tumor protein, translationally-controlled 1 [ Homo sapiens ]
Official Symbol TPT1
Synonyms TPT1; tumor protein, translationally-controlled 1; translationally-controlled tumor protein; fortilin; TCTP; p23; histamine-releasing factor; HRF; p02; FLJ27337;
Gene ID 7178
mRNA Refseq NM_003295
Protein Refseq NP_003286
MIM 600763
UniProt ID P13693
Chromosome Location 13q14
Pathway PLK1 signaling events, organism-specific biosystem;
Function calcium ion binding; transcription factor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TPT1 Products

Required fields are marked with *

My Review for All TPT1 Products

Required fields are marked with *

0
cart-icon