Recombinant Human TPT1 protein, T7/His-tagged

• Cat.No.: TPT1-214H
• Product Overview: Recombinant human TPT1 cDNA (2 – 172 aa, Isoform-II, derived from BC003352) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 2-172 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, DTT and Sucrose.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSL IGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQI KHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: TPT1 tumor protein, translationally-controlled 1 [ Homo sapiens ]
• Official Symbol: TPT1
• Synonyms: TPT1; tumor protein, translationally-controlled 1; translationally-controlled tumor protein; fortilin; TCTP; p23; histamine-releasing factor; HRF; p02; FLJ27337
• Gene ID: 7178
• mRNA Refseq: NM_003295
• Protein Refseq: NP_003286
• MIM: 600763
• UniProt ID: P13693
• Chromosome Location: 13q14
• Pathway: PLK1 signaling events, organism-specific biosystem
• Function: calcium ion binding; transcription factor binding