Recombinant Human TPT1 protein, T7/His-tagged
| Cat.No. : | TPT1-214H |
| Product Overview : | Recombinant human TPT1 cDNA (2 – 172 aa, Isoform-II, derived from BC003352) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 2-172 a.a. |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, DTT and Sucrose. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSL IGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQI KHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | TPT1 tumor protein, translationally-controlled 1 [ Homo sapiens ] |
| Official Symbol | TPT1 |
| Synonyms | TPT1; tumor protein, translationally-controlled 1; translationally-controlled tumor protein; fortilin; TCTP; p23; histamine-releasing factor; HRF; p02; FLJ27337; |
| Gene ID | 7178 |
| mRNA Refseq | NM_003295 |
| Protein Refseq | NP_003286 |
| MIM | 600763 |
| UniProt ID | P13693 |
| Chromosome Location | 13q14 |
| Pathway | PLK1 signaling events, organism-specific biosystem; |
| Function | calcium ion binding; transcription factor binding; |
| ◆ Recombinant Proteins | ||
| TPT1-9797Z | Recombinant Zebrafish TPT1 | +Inquiry |
| Tpt1-70M | Recombinant Mouse Tpt1, His-tagged | +Inquiry |
| TPT1-0580H | Recombinant Human TPT1 Protein (M1-C172), Tag Free | +Inquiry |
| TPT1-1844H | Recombinant Human TPT1, His-tagged | +Inquiry |
| TPT1-4741R | Recombinant Rhesus Macaque TPT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TPT1-831HCL | Recombinant Human TPT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPT1 Products
Required fields are marked with *
My Review for All TPT1 Products
Required fields are marked with *




