Recombinant Human TRAF3, GST-tagged
Cat.No. : | TRAF3-3385H |
Product Overview : | Recombinant Human TRAF3(1 a.a. - 568 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
Availability | June 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in the signal transduction of CD40, a TNFR family member important for the activation of the immune response. This protein is found to be a critical component of the lymphotoxin-beta receptor (LTbetaR) signaling complex, which induces NF-kappaB activation and cell death initiated by LTbeta ligation. Epstein-Barr virus encoded latent infection membrane protein-1 (LMP1) can interact with this and several other members of the TRAF family, which may be essential for the oncogenic effects of LMP1. Several alternatively spliced transcript variants encoding three distinct isoforms have been reported. |
Molecular Mass : | 90.9 kDa |
AA Sequence : | MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCES CMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVR PDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSEC VNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVA RNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYF GYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPT GEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TRAF3 TNF receptor-associated factor 3 [ Homo sapiens (human) ] |
Official Symbol | TRAF3 |
Synonyms | TRAF3; TNF receptor-associated factor 3; CAP 1; CD40bp; CRAF1; LAP1; CD40 binding protein; CD40 associated protein 1; LMP1-associated protein 1; CD40 receptor associated factor 1; CAP-1 |
Gene ID | 7187 |
mRNA Refseq | NM_003300 |
Protein Refseq | NP_003291 |
MIM | 601896 |
UniProt ID | Q13114 |
Chromosome Location | 14q32.32 |
Pathway | Activated TLR4 signalling; Apoptosis Modulation and Signaling; IL17 signaling pathway |
Function | ligase activity; protein kinase binding; tumor necrosis factor receptor binding; ubiquitin protein ligase binding |
◆ Recombinant Proteins | ||
TRAF3-3617H | Recombinant Human TRAF3 protein, His-tagged | +Inquiry |
TRAF3-3386H | Recombinant Human TRAF3, GST-tagged | +Inquiry |
TRAF3-954Z | Recombinant Zebrafish TRAF3 | +Inquiry |
Traf3-6618M | Recombinant Mouse Traf3 Protein, Myc/DDK-tagged | +Inquiry |
TRAF3-530HF | Recombinant Full Length Human TRAF3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRAF3-823HCL | Recombinant Human TRAF3 293 Cell Lysate | +Inquiry |
TRAF3-822HCL | Recombinant Human TRAF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRAF3 Products
Required fields are marked with *
My Review for All TRAF3 Products
Required fields are marked with *
0
Inquiry Basket