Recombinant Human TRAF3, GST-tagged

Cat.No. : TRAF3-3385H
Product Overview : Recombinant Human TRAF3(1 a.a. - 568 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Availability July 03, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in the signal transduction of CD40, a TNFR family member important for the activation of the immune response. This protein is found to be a critical component of the lymphotoxin-beta receptor (LTbetaR) signaling complex, which induces NF-kappaB activation and cell death initiated by LTbeta ligation. Epstein-Barr virus encoded latent infection membrane protein-1 (LMP1) can interact with this and several other members of the TRAF family, which may be essential for the oncogenic effects of LMP1. Several alternatively spliced transcript variants encoding three distinct isoforms have been reported.
Molecular Mass : 90.9 kDa
AA Sequence : MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCES CMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVR PDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSEC VNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVA RNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYF GYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPT GEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TRAF3 TNF receptor-associated factor 3 [ Homo sapiens (human) ]
Official Symbol TRAF3
Synonyms TRAF3; TNF receptor-associated factor 3; CAP 1; CD40bp; CRAF1; LAP1; CD40 binding protein; CD40 associated protein 1; LMP1-associated protein 1; CD40 receptor associated factor 1; CAP-1
Gene ID 7187
mRNA Refseq NM_003300
Protein Refseq NP_003291
MIM 601896
UniProt ID Q13114
Chromosome Location 14q32.32
Pathway Activated TLR4 signalling; Apoptosis Modulation and Signaling; IL17 signaling pathway
Function ligase activity; protein kinase binding; tumor necrosis factor receptor binding; ubiquitin protein ligase binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRAF3 Products

Required fields are marked with *

My Review for All TRAF3 Products

Required fields are marked with *

0
cart-icon