Recombinant Human TRAF4, His-tagged

Cat.No. : TRAF4-31602TH
Product Overview : Recombinant fragment, corresponding to amino acids 207-406 of Human TRAF4 with an N terminal His tag. Predicted MWt: 23kDa;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 207-406 a.a.
Description : This gene encodes a member of the TNF receptor associated factor (TRAF) family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. The encoded protein has been shown to interact with neurotrophin receptor, p75 (NTR/NTSR1), and negatively regulate NTR induced cell death and NF-kappa B activation. This protein has been found to bind to p47phox, a cytosolic regulatory factor included in a multi-protein complex known as NAD(P)H oxidase. This protein thus, is thought to be involved in the oxidative activation of MAPK8/JNK. Alternatively spliced transcript variants have been observed but the full-length nature of only one has been determined.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 138 μl distilled water.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : IQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTA LVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMCAL VSRQRQELQELRRELEELSVGSDGVLIWKIGSYGRRLQ EAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEG THLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAK PQHVTE
Gene Name TRAF4 TNF receptor-associated factor 4 [ Homo sapiens ]
Official Symbol TRAF4
Synonyms TRAF4; TNF receptor-associated factor 4; CART1; MLN62; RNF83;
Gene ID 9618
mRNA Refseq NM_004295
Protein Refseq NP_004286
MIM 602464
Uniprot ID Q9BUZ4
Chromosome Location 17q11-q21.3
Pathway Pathways in cancer, organism-specific biosystem; Small cell lung cancer, organism-specific biosystem; Small cell lung cancer, conserved biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem;
Function DNA binding; WW domain binding; metal ion binding; protein binding; protein kinase binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRAF4 Products

Required fields are marked with *

My Review for All TRAF4 Products

Required fields are marked with *

0
cart-icon
0
compare icon