Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human TRAF4, His-tagged

Cat.No. : TRAF4-31602TH
Product Overview : Recombinant fragment, corresponding to amino acids 207-406 of Human TRAF4 with an N terminal His tag. Predicted MWt: 23kDa;
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the TNF receptor associated factor (TRAF) family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. The encoded protein has been shown to interact with neurotrophin receptor, p75 (NTR/NTSR1), and negatively regulate NTR induced cell death and NF-kappa B activation. This protein has been found to bind to p47phox, a cytosolic regulatory factor included in a multi-protein complex known as NAD(P)H oxidase. This protein thus, is thought to be involved in the oxidative activation of MAPK8/JNK. Alternatively spliced transcript variants have been observed but the full-length nature of only one has been determined.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 138 μl distilled water.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : IQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTA LVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMCAL VSRQRQELQELRRELEELSVGSDGVLIWKIGSYGRRLQ EAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEG THLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAK PQHVTE
Gene Name : TRAF4 TNF receptor-associated factor 4 [ Homo sapiens ]
Official Symbol : TRAF4
Synonyms : TRAF4; TNF receptor-associated factor 4; CART1; MLN62; RNF83;
Gene ID : 9618
mRNA Refseq : NM_004295
Protein Refseq : NP_004286
MIM : 602464
Uniprot ID : Q9BUZ4
Chromosome Location : 17q11-q21.3
Pathway : Pathways in cancer, organism-specific biosystem; Small cell lung cancer, organism-specific biosystem; Small cell lung cancer, conserved biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem;
Function : DNA binding; WW domain binding; metal ion binding; protein binding; protein kinase binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends