Recombinant Human TRAF4, His-tagged
Cat.No. : | TRAF4-31602TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 207-406 of Human TRAF4 with an N terminal His tag. Predicted MWt: 23kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 207-406 a.a. |
Description : | This gene encodes a member of the TNF receptor associated factor (TRAF) family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. The encoded protein has been shown to interact with neurotrophin receptor, p75 (NTR/NTSR1), and negatively regulate NTR induced cell death and NF-kappa B activation. This protein has been found to bind to p47phox, a cytosolic regulatory factor included in a multi-protein complex known as NAD(P)H oxidase. This protein thus, is thought to be involved in the oxidative activation of MAPK8/JNK. Alternatively spliced transcript variants have been observed but the full-length nature of only one has been determined. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 138 μl distilled water. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | IQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTA LVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMCAL VSRQRQELQELRRELEELSVGSDGVLIWKIGSYGRRLQ EAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEG THLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAK PQHVTE |
Gene Name | TRAF4 TNF receptor-associated factor 4 [ Homo sapiens ] |
Official Symbol | TRAF4 |
Synonyms | TRAF4; TNF receptor-associated factor 4; CART1; MLN62; RNF83; |
Gene ID | 9618 |
mRNA Refseq | NM_004295 |
Protein Refseq | NP_004286 |
MIM | 602464 |
Uniprot ID | Q9BUZ4 |
Chromosome Location | 17q11-q21.3 |
Pathway | Pathways in cancer, organism-specific biosystem; Small cell lung cancer, organism-specific biosystem; Small cell lung cancer, conserved biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; |
Function | DNA binding; WW domain binding; metal ion binding; protein binding; protein kinase binding; |
◆ Recombinant Proteins | ||
TRAF4-558H | Recombinant Human TRAF4 Protein, His-tagged | +Inquiry |
TRAF4-17289M | Recombinant Mouse TRAF4 Protein | +Inquiry |
TRAF4-550H | Recombinant Human TRAF4 Protein, GST-His-tagged | +Inquiry |
TRAF4-6711H | Recombinant Human TRAF4 Protein (Gln193-Asp444), His tagged | +Inquiry |
TRAF4-3387H | Recombinant Human TRAF4, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRAF4-820HCL | Recombinant Human TRAF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRAF4 Products
Required fields are marked with *
My Review for All TRAF4 Products
Required fields are marked with *
0
Inquiry Basket