Recombinant Human transgelin Protein, His Tagged
Cat.No. : | TAGLN-30925TH |
Product Overview : | Recombinant Human transgelin protein (1-201 aa) with His tag was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-201 aa |
Description : | This gene encodes a shape change and transformation sensitive actin-binding protein which belongs to the calponin family. It is ubiquitously expressed in vascular and visceral smooth muscle, and is an early marker of smooth muscle differentiation. The encoded protein is thought to be involved in calcium-independent smooth muscle contraction. It acts as a tumor suppressor, and the loss of its expression is an early event in cell transformation and the development of some tumors, coinciding with cellular plasticity. The encoded protein has a domain architecture consisting of an N-terminal calponin homology (CH) domain and a C-terminal calponin-like (CLIK) domain. Mice with a knockout of the orthologous gene are viable and fertile but their vascular smooth muscle cells exhibit alterations in the distribution of the actin filament and changes in cytoskeletal organization. |
Molecular Mass : | 24 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS |
Endotoxin : | < 1 EU/μg by LAL. |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 1.1 mg/mL by BCA |
Gene Name | TAGLN transgelin [ Homo sapiens (human) ] |
Official Symbol | TAGLN |
Synonyms | TAGLN; transgelin; DKFZp686P11128; SM22; SM22 alpha; SMCC; TAGLN1; transgelin variant 2; WS3 10; SM22-alpha; 22 kDa actin-binding protein; smooth muscle protein 22-alpha; WS3-10; DKFZp686B01212; |
Gene ID | 6876 |
mRNA Refseq | NM_001001522 |
Protein Refseq | NP_001001522 |
MIM | 600818 |
UniProt ID | Q01995 |
◆ Recombinant Proteins | ||
TAGLN-8978M | Recombinant Mouse TAGLN Protein, His (Fc)-Avi-tagged | +Inquiry |
TAGLN-302H | Recombinant Human TAGLN protein, MYC/DDK-tagged | +Inquiry |
TAGLN-8835HFL | Recombinant Full Length Human TAGLN protein, Flag-tagged | +Inquiry |
TAGLN-5578R | Recombinant Rat TAGLN Protein, His (Fc)-Avi-tagged | +Inquiry |
TAGLN-744C | Recombinant Cynomolgus Monkey TAGLN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAGLN-1262HCL | Recombinant Human TAGLN 293 Cell Lysate | +Inquiry |
TAGLN-1263HCL | Recombinant Human TAGLN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TAGLN Products
Required fields are marked with *
My Review for All TAGLN Products
Required fields are marked with *
0
Inquiry Basket