Recombinant Human TRAPPC2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TRAPPC2-3272H
Product Overview : TRAPPC2 MS Standard C13 and N15-labeled recombinant protein (NP_001011658) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is thought to be part of a large multi-subunit complex involved in the targeting and fusion of endoplasmic reticulum-to-Golgi transport vesicles with their acceptor compartment. In addition, the encoded protein can bind c-myc promoter-binding protein 1 and block its transcriptional repression capability. Mutations in this gene are a cause of spondyloepiphyseal dysplasia tarda (SEDT). A processed pseudogene of this gene is located on chromosome 19, and other pseudogenes are found on chromosomes 8 and Y. Alternatively spliced transcript variants have been found for this gene.
Molecular Mass : 16.4 kDa
AA Sequence : MSGSFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGHMRFIMLHDIRQEDGIKNFFTDVYDLYIKFSMNPFYEPNSPIRSSAFDRKVQFLGKKHLLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TRAPPC2 trafficking protein particle complex 2 [ Homo sapiens (human) ]
Official Symbol TRAPPC2
Synonyms TRAPPC2; trafficking protein particle complex 2; SEDL, spondyloepiphyseal dysplasia, late; trafficking protein particle complex subunit 2; hYP38334; MIP 2A; SEDT; TRS20; ZNF547L; sedlin; SEDL; MIP2A; TRAPPC2P1;
Gene ID 6399
mRNA Refseq NM_001011658
Protein Refseq NP_001011658
MIM 300202
UniProt ID P0DI81

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRAPPC2 Products

Required fields are marked with *

My Review for All TRAPPC2 Products

Required fields are marked with *

0
cart-icon