Recombinant Human TRAPPC2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TRAPPC2-3272H |
Product Overview : | TRAPPC2 MS Standard C13 and N15-labeled recombinant protein (NP_001011658) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is thought to be part of a large multi-subunit complex involved in the targeting and fusion of endoplasmic reticulum-to-Golgi transport vesicles with their acceptor compartment. In addition, the encoded protein can bind c-myc promoter-binding protein 1 and block its transcriptional repression capability. Mutations in this gene are a cause of spondyloepiphyseal dysplasia tarda (SEDT). A processed pseudogene of this gene is located on chromosome 19, and other pseudogenes are found on chromosomes 8 and Y. Alternatively spliced transcript variants have been found for this gene. |
Molecular Mass : | 16.4 kDa |
AA Sequence : | MSGSFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGHMRFIMLHDIRQEDGIKNFFTDVYDLYIKFSMNPFYEPNSPIRSSAFDRKVQFLGKKHLLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TRAPPC2 trafficking protein particle complex 2 [ Homo sapiens (human) ] |
Official Symbol | TRAPPC2 |
Synonyms | TRAPPC2; trafficking protein particle complex 2; SEDL, spondyloepiphyseal dysplasia, late; trafficking protein particle complex subunit 2; hYP38334; MIP 2A; SEDT; TRS20; ZNF547L; sedlin; SEDL; MIP2A; TRAPPC2P1; |
Gene ID | 6399 |
mRNA Refseq | NM_001011658 |
Protein Refseq | NP_001011658 |
MIM | 300202 |
UniProt ID | P0DI81 |
◆ Recombinant Proteins | ||
TRAPPC2-1410C | Recombinant Chicken TRAPPC2 | +Inquiry |
TRAPPC2-4599Z | Recombinant Zebrafish TRAPPC2 | +Inquiry |
Trappc2-6626M | Recombinant Mouse Trappc2 Protein, Myc/DDK-tagged | +Inquiry |
TRAPPC2-356H | Recombinant Human trafficking protein particle complex 2, His-tagged | +Inquiry |
TRAPPC2-3272H | Recombinant Human TRAPPC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRAPPC2-809HCL | Recombinant Human TRAPPC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRAPPC2 Products
Required fields are marked with *
My Review for All TRAPPC2 Products
Required fields are marked with *
0
Inquiry Basket