Recombinant Human TRAPPC2L Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TRAPPC2L-3151H
Product Overview : TRAPPC2L MS Standard C13 and N15-labeled recombinant protein (NP_057293) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein that interacts with the tethering factor trafficking protein particle (TRAPP complex). TRAPP complexes mediate the contact between vescicles and target membranes, and thus, are involved in vescicle-mediated transport of proteins and lipids. The encoded protein is related to the X-linked trafficking protein particle complex 2. A related pseudogene is located on the X chromosome. Alternative splicing results in multiple transcript variants encoding different isoforms.
Molecular Mass : 16.1 kDa
AA Sequence : MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVYGYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNPGDRIQSSRAFDNMVTSMMIQVCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TRAPPC2L trafficking protein particle complex 2-like [ Homo sapiens (human) ]
Official Symbol TRAPPC2L
Synonyms TRAPPC2L; trafficking protein particle complex 2-like; PERRB; HSPC176; trafficking protein particle complex subunit 2-like protein; hematopoietic stem/progenitor cells 176
Gene ID 51693
mRNA Refseq NM_016209
Protein Refseq NP_057293
MIM 610970
UniProt ID Q9UL33

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRAPPC2L Products

Required fields are marked with *

My Review for All TRAPPC2L Products

Required fields are marked with *

0
cart-icon
0
compare icon