Recombinant Human TRAPPC2L Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TRAPPC2L-3151H |
Product Overview : | TRAPPC2L MS Standard C13 and N15-labeled recombinant protein (NP_057293) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein that interacts with the tethering factor trafficking protein particle (TRAPP complex). TRAPP complexes mediate the contact between vescicles and target membranes, and thus, are involved in vescicle-mediated transport of proteins and lipids. The encoded protein is related to the X-linked trafficking protein particle complex 2. A related pseudogene is located on the X chromosome. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Molecular Mass : | 16.1 kDa |
AA Sequence : | MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVYGYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNPGDRIQSSRAFDNMVTSMMIQVCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TRAPPC2L trafficking protein particle complex 2-like [ Homo sapiens (human) ] |
Official Symbol | TRAPPC2L |
Synonyms | TRAPPC2L; trafficking protein particle complex 2-like; PERRB; HSPC176; trafficking protein particle complex subunit 2-like protein; hematopoietic stem/progenitor cells 176 |
Gene ID | 51693 |
mRNA Refseq | NM_016209 |
Protein Refseq | NP_057293 |
MIM | 610970 |
UniProt ID | Q9UL33 |
◆ Recombinant Proteins | ||
TRAPPC2L-241H | Recombinant Human trafficking protein particle complex 2-like, His-tagged | +Inquiry |
TRAPPC2L-9569M | Recombinant Mouse TRAPPC2L Protein, His (Fc)-Avi-tagged | +Inquiry |
TRAPPC2L-6262R | Recombinant Rat TRAPPC2L Protein | +Inquiry |
TRAPPC2L-4944R | Recombinant Rhesus monkey TRAPPC2L Protein, His-tagged | +Inquiry |
TRAPPC2L-5919R | Recombinant Rat TRAPPC2L Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRAPPC2L-808HCL | Recombinant Human TRAPPC2L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRAPPC2L Products
Required fields are marked with *
My Review for All TRAPPC2L Products
Required fields are marked with *