Recombinant Human TRAPPC3 protein, His-tagged
Cat.No. : | TRAPPC3-3392H |
Product Overview : | Recombinant Human TRAPPC3 protein(1-180 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-180 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | TRAPPC3 |
Synonyms | TRAPPC3; trafficking protein particle complex 3; trafficking protein particle complex subunit 3; BET3; BET3 homolog; 1110058K12Rik; |
Gene ID | 27095 |
mRNA Refseq | NM_014408 |
Protein Refseq | NP_055223 |
MIM | 610955 |
UniProt ID | O43617 |
◆ Recombinant Proteins | ||
TRAPPC3-1829C | Recombinant Chicken TRAPPC3 | +Inquiry |
TRAPPC3-9570M | Recombinant Mouse TRAPPC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRAPPC3-1028Z | Recombinant Zebrafish TRAPPC3 | +Inquiry |
TRAPPC3-5920R | Recombinant Rat TRAPPC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRAPPC3-301638H | Recombinant Human TRAPPC3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRAPPC3-807HCL | Recombinant Human TRAPPC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRAPPC3 Products
Required fields are marked with *
My Review for All TRAPPC3 Products
Required fields are marked with *