Recombinant Human TRAT1 Protein, His-tagged
Cat.No. : | TRAT1-492H |
Product Overview : | Recombinant Human TRAT1 fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | Supplied as a 0.2 µM filtered solution of PBS, 10% Glycerol, pH 7.4 |
Molecular Mass : | 19.4kD |
AA Sequence : | MNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPINLEHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | TRAT1 T cell receptor associated transmembrane adaptor 1 [ Homo sapiens ] |
Official Symbol | TRAT1 |
Synonyms | TRAT1; T cell receptor associated transmembrane adaptor 1; T cell receptor interacting molecule , TCRIM; T-cell receptor-associated transmembrane adapter 1; HSPC062; TRIM; pp29/30; T cell receptor interacting molecule; T-cell receptor interacting molecule; T-cell receptor-interacting molecule; TCRIM; |
Gene ID | 50852 |
mRNA Refseq | NM_016388 |
Protein Refseq | NP_057472 |
MIM | 604962 |
UniProt ID | Q6PIZ9 |
◆ Recombinant Proteins | ||
TRAT1-9574M | Recombinant Mouse TRAT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRAT1-958H | Recombinant Human TRAT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TR1-2630H | Recombinant Human TRat 1 Protein, MYC/DDK-tagged | +Inquiry |
TRAT1-3398H | Recombinant Human TRAT1, His-tagged | +Inquiry |
TRAT1-17314M | Recombinant Mouse TRAT1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRAT1-701HCL | Recombinant Human TRAT1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRAT1 Products
Required fields are marked with *
My Review for All TRAT1 Products
Required fields are marked with *