Recombinant Human TRAT1 Protein, His-tagged

Cat.No. : TRAT1-492H
Product Overview : Recombinant Human TRAT1 fused with His tag at C-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Form : Supplied as a 0.2 µM filtered solution of PBS, 10% Glycerol, pH 7.4
Molecular Mass : 19.4kD
AA Sequence : MNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPINLEHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name TRAT1 T cell receptor associated transmembrane adaptor 1 [ Homo sapiens ]
Official Symbol TRAT1
Synonyms TRAT1; T cell receptor associated transmembrane adaptor 1; T cell receptor interacting molecule , TCRIM; T-cell receptor-associated transmembrane adapter 1; HSPC062; TRIM; pp29/30; T cell receptor interacting molecule; T-cell receptor interacting molecule; T-cell receptor-interacting molecule; TCRIM;
Gene ID 50852
mRNA Refseq NM_016388
Protein Refseq NP_057472
MIM 604962
UniProt ID Q6PIZ9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRAT1 Products

Required fields are marked with *

My Review for All TRAT1 Products

Required fields are marked with *

0
cart-icon