Recombinant Human TRAT1 Protein, His-tagged

• Cat.No.: TRAT1-492H
• Product Overview: Recombinant Human TRAT1 fused with His tag at C-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Form: Supplied as a 0.2 µM filtered solution of PBS, 10% Glycerol, pH 7.4
• Molecular Mass: 19.4kD
• AA Sequence: MNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPINLEHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: TRAT1 T cell receptor associated transmembrane adaptor 1 [ Homo sapiens ]
• Official Symbol: TRAT1
• Synonyms: TRAT1; T cell receptor associated transmembrane adaptor 1; T cell receptor interacting molecule , TCRIM; T-cell receptor-associated transmembrane adapter 1; HSPC062; TRIM; pp29/30; T cell receptor interacting molecule; T-cell receptor interacting molecule; T-cell receptor-interacting molecule; TCRIM
• Gene ID: 50852
• mRNA Refseq: NM_016388
• Protein Refseq: NP_057472
• MIM: 604962
• UniProt ID: Q6PIZ9