Recombinant Human TRAV21 Protein, His-tagged
| Cat.No. : | TRAV21-03H |
| Product Overview : | Recombinant Human TRAV21 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Form : | PBS, pH 8.0 |
| Molecular Mass : | 26.6 kDa |
| AA Sequence : | MHHHHHHMQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRPTSGGSYIPTFGRGTSLIVHPYGGGGSGGGGSGGGGSMGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSYVGNTGELFFGEGSRLTVL |
| Purity : | > 90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.68 mg/ml |
| Official Symbol | TRAV21 |
| Synonyms | TCRAV21S1; TCRAV23S1 |
| Gene ID | 28662 |
| UniProt ID | A0A0B4J279 |
| ◆ Recombinant Proteins | ||
| TRAV21-69H | Recombinant Human TRAV21 Protein, His-tagged | +Inquiry |
| TRAV21-03H | Recombinant Human TRAV21 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRAV21 Products
Required fields are marked with *
My Review for All TRAV21 Products
Required fields are marked with *



