Recombinant Human TREM1 Protein, C-His-tagged
Cat.No. : | TREM1-116H |
Product Overview : | Recombinant Human TREM1 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | TREM-1 (triggering receptor expressed on myeloid cells-1) is expressed in monocytes and neutrophils but not in lymphocytes, dendritic cells, or other cell types. TREM-1 is a glycoprotein that is reduced by deglycosylation, in agreement with the predicted molecular mass. TREM-1 is an activating receptor of the Ig superfamily that is expressed on human myeloid cells, selectively expressed on blood neutrophils and a subset of monocytes, and is upregulated by bacterial LPS. Immunoblot analysis shows that TREM-1 is associated with DAP12, a molecule frequently associated with activating receptors. TREM-1 and the myeloid DAP12-associating lectin (MDL-1) are recently identified receptors which associate non-covalently with DAP12 to form receptor complexes that are involved in monocytic activation and inflammatory response. |
Molecular Mass : | ~20 kDa |
AA Sequence : | ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVPVFN |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | TREM1 triggering receptor expressed on myeloid cells 1 [ Homo sapiens (human) ] |
Official Symbol | TREM1 |
Synonyms | TREM1; triggering receptor expressed on myeloid cells 1; CD354; TREM 1; triggering-receptor TREM1; triggering receptor expressed on monocytes 1; TREM-1; |
Gene ID | 54210 |
mRNA Refseq | NM_001242589 |
Protein Refseq | NP_001229518 |
MIM | 605085 |
UniProt ID | Q9NP99 |
◆ Recombinant Proteins | ||
TREM1-7203H | Recombinant Human Triggering Receptor Expressed On Myeloid Cells 1, His-tagged | +Inquiry |
Trem1-17319M | Recombinant Mouse Trem1 protein, His-tagged | +Inquiry |
TREM1-4948H | Recombinant Human TREM1 Protein (Met1-Arg200), C-His tagged | +Inquiry |
TREM1-211H | Recombinant Human triggering receptor expressed on myeloid cells 1 Protein, His&Flag tagged | +Inquiry |
TREM1-485H | Recombinant Human TREM1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TREM1-2140HCL | Recombinant Human TREM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TREM1 Products
Required fields are marked with *
My Review for All TREM1 Products
Required fields are marked with *
0
Inquiry Basket