Recombinant Human TREM1 protein, T7/His-tagged

Cat.No. : TREM1-167H
Product Overview : Recombinant human CD354 extracellular domain cDNA (21 - 2305aa, Isoform-1) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 21-2305 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKT LACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTP GSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVPVFN
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro CD354 mediated neutrophil and monocyte-related inflammatory responses regulatory study with this protein as either soluble factor or coating matrix protein.2. May be used for CD354 protein-protein interaction assay.3. Potential diagnostic biomarker for systematic infections, such as bacterial lung infection, et al.4. May be used for specific antibody production.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name TREM1 triggering receptor expressed on myeloid cells 1 [ Homo sapiens ]
Official Symbol TREM1
Synonyms TREM1; triggering receptor expressed on myeloid cells 1; CD354; TREM 1; triggering-receptor TREM1; triggering receptor expressed on monocytes 1; TREM-1;
Gene ID 54210
mRNA Refseq NM_001242589
Protein Refseq NP_001229518
MIM 605085
UniProt ID Q9NP99
Chromosome Location 6p21.1
Pathway Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem;
Function receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TREM1 Products

Required fields are marked with *

My Review for All TREM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon