Recombinant Human TREM1 protein, T7/His-tagged
| Cat.No. : | TREM1-167H |
| Product Overview : | Recombinant human CD354 extracellular domain cDNA (21 - 2305aa, Isoform-1) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 21-2305 a.a. |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKT LACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTP GSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVPVFN |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro CD354 mediated neutrophil and monocyte-related inflammatory responses regulatory study with this protein as either soluble factor or coating matrix protein.2. May be used for CD354 protein-protein interaction assay.3. Potential diagnostic biomarker for systematic infections, such as bacterial lung infection, et al.4. May be used for specific antibody production. |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | TREM1 triggering receptor expressed on myeloid cells 1 [ Homo sapiens ] |
| Official Symbol | TREM1 |
| Synonyms | TREM1; triggering receptor expressed on myeloid cells 1; CD354; TREM 1; triggering-receptor TREM1; triggering receptor expressed on monocytes 1; TREM-1; |
| Gene ID | 54210 |
| mRNA Refseq | NM_001242589 |
| Protein Refseq | NP_001229518 |
| MIM | 605085 |
| UniProt ID | Q9NP99 |
| Chromosome Location | 6p21.1 |
| Pathway | Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; |
| Function | receptor activity; |
| ◆ Recombinant Proteins | ||
| TREM1-212H | Recombinant Human TREM1 Protein, His-tagged | +Inquiry |
| TREM1-2687H | Recombinant Human TREM1 protein, hFc&His-tagged | +Inquiry |
| TREM1-167H | Recombinant Human TREM1 protein, T7/His-tagged | +Inquiry |
| TREM1-214P | Recombinant Pig TREM1 Protein, His-tagged | +Inquiry |
| TREM1-1780R | Recombinant Rhesus Monkey TREM1 Protein, hIgG1-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TREM1-2140HCL | Recombinant Human TREM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TREM1 Products
Required fields are marked with *
My Review for All TREM1 Products
Required fields are marked with *



