Recombinant Human TREM1 protein, T7/His-tagged
Cat.No. : | TREM1-167H |
Product Overview : | Recombinant human CD354 extracellular domain cDNA (21 - 2305aa, Isoform-1) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 21-2305 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKT LACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTP GSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVPVFN |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro CD354 mediated neutrophil and monocyte-related inflammatory responses regulatory study with this protein as either soluble factor or coating matrix protein.2. May be used for CD354 protein-protein interaction assay.3. Potential diagnostic biomarker for systematic infections, such as bacterial lung infection, et al.4. May be used for specific antibody production. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | TREM1 triggering receptor expressed on myeloid cells 1 [ Homo sapiens ] |
Official Symbol | TREM1 |
Synonyms | TREM1; triggering receptor expressed on myeloid cells 1; CD354; TREM 1; triggering-receptor TREM1; triggering receptor expressed on monocytes 1; TREM-1; |
Gene ID | 54210 |
mRNA Refseq | NM_001242589 |
Protein Refseq | NP_001229518 |
MIM | 605085 |
UniProt ID | Q9NP99 |
Chromosome Location | 6p21.1 |
Pathway | Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; |
Function | receptor activity; |
◆ Recombinant Proteins | ||
TREM1-285H | Recombinant Human Soluble triggering receptor expressed on myeloid cells 1, His-tagged | +Inquiry |
TREM1-485H | Recombinant Human TREM1 Protein, His-tagged | +Inquiry |
TREM1-30119TH | Recombinant Human TREM1, His-tagged | +Inquiry |
TREM1-7203H | Recombinant Human Triggering Receptor Expressed On Myeloid Cells 1, His-tagged | +Inquiry |
TREM1-4948H | Recombinant Human TREM1 Protein (Met1-Arg200), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TREM1-2140HCL | Recombinant Human TREM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TREM1 Products
Required fields are marked with *
My Review for All TREM1 Products
Required fields are marked with *
0
Inquiry Basket