Recombinant Human TREM1 protein, T7/His-tagged

• Cat.No.: TREM1-167H
• Product Overview: Recombinant human CD354 extracellular domain cDNA (21 - 2305aa, Isoform-1) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 21-2305 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKT LACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTP GSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVPVFN
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro CD354 mediated neutrophil and monocyte-related inflammatory responses regulatory study with this protein as either soluble factor or coating matrix protein.2. May be used for CD354 protein-protein interaction assay.3. Potential diagnostic biomarker for systematic infections, such as bacterial lung infection, et al.4. May be used for specific antibody production.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: TREM1 triggering receptor expressed on myeloid cells 1 [ Homo sapiens ]
• Official Symbol: TREM1
• Synonyms: TREM1; triggering receptor expressed on myeloid cells 1; CD354; TREM 1; triggering-receptor TREM1; triggering receptor expressed on monocytes 1; TREM-1
• Gene ID: 54210
• mRNA Refseq: NM_001242589
• Protein Refseq: NP_001229518
• MIM: 605085
• UniProt ID: Q9NP99
• Chromosome Location: 6p21.1
• Pathway: Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem
• Function: receptor activity