Recombinant Human TREM1 protein, T7/His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human TREM1 protein, T7/His-tagged

Recombinant Human TREM1 protein, T7/His-tagged

TREM1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : TREM1-167H
Product Overview : Recombinant human CD354 extracellular domain cDNA (21 - 2305aa, Isoform-1) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source : E. coli
Species : Human
Tag : T7/His
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKT LACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTP GSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVPVFN
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro CD354 mediated neutrophil and monocyte-related inflammatory responses regulatory study with this protein as either soluble factor or coating matrix protein.2. May be used for CD354 protein-protein interaction assay.3. Potential diagnostic biomarker for systematic infections, such as bacterial lung infection, et al.4. May be used for specific antibody production.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name : TREM1 triggering receptor expressed on myeloid cells 1 [ Homo sapiens ]
Official Symbol : TREM1
Synonyms : TREM1; triggering receptor expressed on myeloid cells 1; CD354; TREM 1; triggering-receptor TREM1; triggering receptor expressed on monocytes 1; TREM-1;
Gene ID : 54210
mRNA Refseq : NM_001242589
Protein Refseq : NP_001229518
MIM : 605085
UniProt ID : Q9NP99
Chromosome Location : 6p21.1
Pathway : Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem;
Function : receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.