Recombinant Human TREM2 Protein (19-174 aa), His-tagged

Cat.No. : TREM2-1933H
Product Overview : Recombinant Human TREM2 Protein (19-174 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 19-174 aa
Description : May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 19.4 kDa
AA Sequence : HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name TREM2 triggering receptor expressed on myeloid cells 2 [ Homo sapiens ]
Official Symbol TREM2
Synonyms TREM2; TREM 2; Trem2a; Trem2b; Trem2c; TREM-2;
Gene ID 54209
mRNA Refseq NM_018965
Protein Refseq NP_061838
MIM 605086
UniProt ID Q9NZC2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TREM2 Products

Required fields are marked with *

My Review for All TREM2 Products

Required fields are marked with *

0
cart-icon