Recombinant Human TREM2 Protein (19-174 aa), His-tagged
| Cat.No. : | TREM2-1933H |
| Product Overview : | Recombinant Human TREM2 Protein (19-174 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 19-174 aa |
| Description : | May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 19.4 kDa |
| AA Sequence : | HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | TREM2 triggering receptor expressed on myeloid cells 2 [ Homo sapiens ] |
| Official Symbol | TREM2 |
| Synonyms | TREM2; TREM 2; Trem2a; Trem2b; Trem2c; TREM-2; |
| Gene ID | 54209 |
| mRNA Refseq | NM_018965 |
| Protein Refseq | NP_061838 |
| MIM | 605086 |
| UniProt ID | Q9NZC2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TREM2 Products
Required fields are marked with *
My Review for All TREM2 Products
Required fields are marked with *



