Recombinant Human TREM2 Protein (19-174 aa), His-tagged

• Cat.No.: TREM2-1933H
• Product Overview: Recombinant Human TREM2 Protein (19-174 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 19-174 aa
• Description: May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 19.4 kDa
• AA Sequence: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: TREM2 triggering receptor expressed on myeloid cells 2 [ Homo sapiens ]
• Official Symbol: TREM2
• Synonyms: TREM2; TREM 2; Trem2a; Trem2b; Trem2c; TREM-2
• Gene ID: 54209
• mRNA Refseq: NM_018965
• Protein Refseq: NP_061838
• MIM: 605086
• UniProt ID: Q9NZC2