"TREM2" Related Products

Expand
Expand

Recombinant Human TREM2 Protein (19-174 aa), His-tagged

Cat.No.: TREM2-1933H
Product Overview: Recombinant Human TREM2 Protein (19-174 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.
Description: May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells.
Source: Yeast
Species: Human
Tag : His
Form: Tris-based buffer,50% glycerol
Molecular Mass: 19.4 kDa
Protein length: 19-174 aa
AA Sequence: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
Purity: > 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name: TREM2 triggering receptor expressed on myeloid cells 2 [ Homo sapiens ]
Official Symbol: TREM2
Synonyms: TREM2; TREM 2; Trem2a; Trem2b; Trem2c; TREM-2;
Gene ID: 54209
mRNA Refseq: NM_018965
Protein Refseq: NP_061838
MIM: 605086
UniProt ID: Q9NZC2

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.