Recombinant Human TREM2 Protein (19-174aa), C-His-tagged
| Cat.No. : | TREM2-04H |
| Product Overview : | Recombinant human TREM2 (19-174aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques. |
| Availability | January 14, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 19-174aa |
| Description : | This gene encodes a membrane protein that forms a receptor signaling complex with the TYRO protein tyrosine kinase binding protein. The encoded protein functions in immune response and may be involved in chronic inflammation by triggering the production of constitutive inflammatory cytokines. Defects in this gene are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL). Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Form : | Liquid |
| Molecular Mass : | 18.2 kDa (162aa) |
| AA Sequence : | HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS |
| Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
| Purity : | > 95% by SDS-PAGE |
| Applications : | SDS-PAGE |
| Notes : | Note: For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 1 mg/mL (determined by absorbance at 280nm) |
| Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| Gene Name | TREM2 triggering receptor expressed on myeloid cells 2 [ Homo sapiens (human) ] |
| Official Symbol | TREM2 |
| Synonyms | TREM2; triggering receptor expressed on myeloid cells 2; PLOSL2; TREM-2; Trem2a; Trem2b; Trem2c; triggering receptor expressed on myeloid cells 2; triggering receptor expressed on monocytes 2; triggering receptor expressed on myeloid cells 2a |
| Gene ID | 54209 |
| mRNA Refseq | NM_018965 |
| Protein Refseq | NP_061838 |
| MIM | 605086 |
| UniProt ID | Q9NZC2 |
| ◆ Recombinant Proteins | ||
| TREM2-2452H | Recombinant human TREM2, His-tagged | +Inquiry |
| TREM2-282H | Active Recombinant Human TREM2 Protein, His-tagged | +Inquiry |
| Trem2-311M | Active Recombinant Mouse Trem2 protein, His-tagged | +Inquiry |
| TREM2-283H | Recombinant Human TREM2 protein, hFc-tagged | +Inquiry |
| Trem2-3621M | Recombinant Mouse Trem2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TREM2-2649HCL | Recombinant Human TREM2 cell lysate | +Inquiry |
| TREM2-2186MCL | Recombinant Mouse TREM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TREM2 Products
Required fields are marked with *
My Review for All TREM2 Products
Required fields are marked with *
