Recombinant Human TREM2 Protein (19-174aa), C-His-tagged

Cat.No. : TREM2-04H
Product Overview : Recombinant human TREM2 (19-174aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
Availability January 14, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 19-174aa
Description : This gene encodes a membrane protein that forms a receptor signaling complex with the TYRO protein tyrosine kinase binding protein. The encoded protein functions in immune response and may be involved in chronic inflammation by triggering the production of constitutive inflammatory cytokines. Defects in this gene are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL). Alternative splicing results in multiple transcript variants encoding different isoforms.
Form : Liquid
Molecular Mass : 18.2 kDa (162aa)
AA Sequence : HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Notes : Note: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name TREM2 triggering receptor expressed on myeloid cells 2 [ Homo sapiens (human) ]
Official Symbol TREM2
Synonyms TREM2; triggering receptor expressed on myeloid cells 2; PLOSL2; TREM-2; Trem2a; Trem2b; Trem2c; triggering receptor expressed on myeloid cells 2; triggering receptor expressed on monocytes 2; triggering receptor expressed on myeloid cells 2a
Gene ID 54209
mRNA Refseq NM_018965
Protein Refseq NP_061838
MIM 605086
UniProt ID Q9NZC2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TREM2 Products

Required fields are marked with *

My Review for All TREM2 Products

Required fields are marked with *

0
cart-icon
0
compare icon