Recombinant Human TRIAP1 protein, GST-tagged
Cat.No. : | TRIAP1-3403H |
Product Overview : | Recombinant Human TRIAP1 protein(1-76 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | August 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-76 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENSS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | TRIAP1 TP53 regulated inhibitor of apoptosis 1 [ Homo sapiens(human) ] |
Official Symbol | TRIAP1 |
Synonyms | TRIAP1; WF-1; MDM35; P53CSV; HSPC132; TP53 regulated inhibitor of apoptosis 1; protein 15E1.1; p53-inducible cell-survival factor; mitochondrial distribution and morphology 35 homolog |
Gene ID | 51499 |
mRNA Refseq | NM_016399 |
Protein Refseq | NP_057483 |
MIM | 614943 |
UniProt ID | O43715 |
◆ Recombinant Proteins | ||
Triap1-6639M | Recombinant Mouse Triap1 Protein, Myc/DDK-tagged | +Inquiry |
TRIAP1-2623H | Recombinant Human TRIAP1 Protein, MYC/DDK-tagged | +Inquiry |
TRIAP1-9587M | Recombinant Mouse TRIAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRIAP1-7427Z | Recombinant Zebrafish TRIAP1 | +Inquiry |
TRIAP1-4900C | Recombinant Chicken TRIAP1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIAP1 Products
Required fields are marked with *
My Review for All TRIAP1 Products
Required fields are marked with *