Recombinant Human TRIB3 protein, GST-tagged
Cat.No. : | TRIB3-301436H |
Product Overview : | Recombinant Human TRIB3 (1-144 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Met144 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization |
AA Sequence : | MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDM |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | TRIB3 tribbles homolog 3 (Drosophila) [ Homo sapiens ] |
Official Symbol | TRIB3 |
Synonyms | TRIB3; tribbles homolog 3 (Drosophila); C20orf97, chromosome 20 open reading frame 97; tribbles homolog 3; dJ1103G7.3; TRB3; TRB-3; p65-interacting inhibitor of NF-kappaB; p65-interacting inhibitor of NF-kappa-B; neuronal cell death inducible putative kinase; neuronal cell death-inducible putative kinase; NIPK; SINK; SKIP3; C20orf97; |
Gene ID | 57761 |
mRNA Refseq | NM_021158 |
Protein Refseq | NP_066981 |
MIM | 607898 |
UniProt ID | Q96RU7 |
◆ Recombinant Proteins | ||
TRIB3-12130Z | Recombinant Zebrafish TRIB3 | +Inquiry |
TRIB3-301436H | Recombinant Human TRIB3 protein, GST-tagged | +Inquiry |
TRIB3-5925R | Recombinant Rat TRIB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRIB3-30123TH | Recombinant Human TRIB3 | +Inquiry |
TRIB3-536HF | Recombinant Full Length Human TRIB3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIB3-657HCL | Recombinant Human TRIB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRIB3 Products
Required fields are marked with *
My Review for All TRIB3 Products
Required fields are marked with *
0
Inquiry Basket