Recombinant Human TRIB3 protein, His-tagged
Cat.No. : | TRIB3-3114H |
Product Overview : | Recombinant Human TRIB3 protein(1-144 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-144 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDM |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | TRIB3 tribbles homolog 3 (Drosophila) [ Homo sapiens ] |
Official Symbol | TRIB3 |
Synonyms | TRIB3; tribbles homolog 3 (Drosophila); C20orf97, chromosome 20 open reading frame 97; tribbles homolog 3; dJ1103G7.3; TRB3; TRB-3; p65-interacting inhibitor of NF-kappaB; p65-interacting inhibitor of NF-kappa-B; neuronal cell death inducible putative kinase; neuronal cell death-inducible putative kinase; NIPK; SINK; SKIP3; C20orf97; |
Gene ID | 57761 |
mRNA Refseq | NM_021158 |
Protein Refseq | NP_066981 |
MIM | 607898 |
UniProt ID | Q96RU7 |
◆ Recombinant Proteins | ||
TRIB3-536HF | Recombinant Full Length Human TRIB3 Protein | +Inquiry |
TRIB3-12130Z | Recombinant Zebrafish TRIB3 | +Inquiry |
TRIB3-6268R | Recombinant Rat TRIB3 Protein | +Inquiry |
TRIB3-30123TH | Recombinant Human TRIB3 | +Inquiry |
TRIB3-3073H | Recombinant Human TRIB3 protein(Met1-Gly358), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIB3-657HCL | Recombinant Human TRIB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIB3 Products
Required fields are marked with *
My Review for All TRIB3 Products
Required fields are marked with *