Recombinant Human TRIB3 protein, His-tagged

Cat.No. : TRIB3-3114H
Product Overview : Recombinant Human TRIB3 protein(1-144 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability December 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-144 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDM
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name TRIB3 tribbles homolog 3 (Drosophila) [ Homo sapiens ]
Official Symbol TRIB3
Synonyms TRIB3; tribbles homolog 3 (Drosophila); C20orf97, chromosome 20 open reading frame 97; tribbles homolog 3; dJ1103G7.3; TRB3; TRB-3; p65-interacting inhibitor of NF-kappaB; p65-interacting inhibitor of NF-kappa-B; neuronal cell death inducible putative kinase; neuronal cell death-inducible putative kinase; NIPK; SINK; SKIP3; C20orf97;
Gene ID 57761
mRNA Refseq NM_021158
Protein Refseq NP_066981
MIM 607898
UniProt ID Q96RU7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRIB3 Products

Required fields are marked with *

My Review for All TRIB3 Products

Required fields are marked with *

0
cart-icon
0
compare icon