Recombinant Human TRIM21 protein, His-tagged
| Cat.No. : | TRIM21-3037H |
| Product Overview : | Recombinant Human TRIM21 protein(176-475 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 12, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 176-475 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRILGEKEAKLAQQSQALQELISELDRRCHSSALELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTGKEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSFYNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TRIM21 tripartite motif containing 21 [ Homo sapiens ] |
| Official Symbol | TRIM21 |
| Synonyms | TRIM21; tripartite motif containing 21; Sjogren syndrome antigen A1 (52kDa, ribonucleoprotein autoantigen SS A/Ro) , SSA1, tripartite motif containing 21; E3 ubiquitin-protein ligase TRIM21; RNF81; RO52; SS-A; ro(SS-A); 52 kDa Ro protein; RING finger protein 81; Sicca syndrome antigen A; tripartite motif-containing 21; sjoegren syndrome type A antigen; tripartite motif-containing protein 21; 52 kDa ribonucleoprotein autoantigen Ro/SS-A; Sjogren syndrome antigen A1 (52kDa, ribonucleoprotein autoantigen SS-A/Ro); SSA; SSA1; |
| Gene ID | 6737 |
| mRNA Refseq | NM_003141 |
| Protein Refseq | NP_003132 |
| MIM | 109092 |
| UniProt ID | P19474 |
| ◆ Recombinant Proteins | ||
| Trim21-1193M | Recombinant Mouse Trim21 protein, His-tagged | +Inquiry |
| Trim21-6646M | Recombinant Mouse Trim21 Protein, Myc/DDK-tagged | +Inquiry |
| TRIM21-5540H | Recombinant Full Length Human TRIM21 protein, His-tagged | +Inquiry |
| TRIM21-4729H | Recombinant Human TRIM21 protein, His-tagged | +Inquiry |
| TRIM21-2685H | Recombinant Human TRIM21 protein(81-260 aa), C-His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| TRIM21-212B | Native Cow TRIM21 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRIM21-791HCL | Recombinant Human TRIM21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIM21 Products
Required fields are marked with *
My Review for All TRIM21 Products
Required fields are marked with *
