Recombinant Human TRIM24 protein, GST-tagged

Cat.No. : TRIM24-316H
Product Overview : Recombinant Human TRIM24(432 a.a. - 569 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 432-569 a.a.
Description : The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains - a RING, a B-box type 1 and a B-box type 2 - and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 40.81 kDa
AA Sequence : PQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPS ISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAFLAQQAIKQW
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name TRIM24 tripartite motif containing 24 [ Homo sapiens ]
Official Symbol TRIM24
Synonyms TRIM24; tripartite motif containing 24; TIF1, transcriptional intermediary factor 1 , tripartite motif containing 24; transcription intermediary factor 1-alpha; hTIF1; RNF82; TIF1A; Tif1a; TIF1-alpha; RING finger protein 82; tripartite motif-containing 24; E3 ubiquitin-protein ligase TRIM24; transcriptional intermediary factor 1; PTC6; TF1A; TIF1; TIF1ALPHA;
Gene ID 8805
mRNA Refseq NM_015905
Protein Refseq NP_056989
MIM 603406
UniProt ID O15164
Chromosome Location 7q32-q34
Pathway Regulation of Androgen receptor activity, organism-specific biosystem;
Function chromatin binding; estrogen response element binding; histone acetyl-lysine binding; ligand-dependent nuclear receptor binding; ligase activity; metal ion binding; NOT methylated histone residue binding; p53 binding; protein binding; protein kinase activity; receptor binding; sequence-specific DNA binding; transcription coactivator activity; ubiquitin-protein ligase activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRIM24 Products

Required fields are marked with *

My Review for All TRIM24 Products

Required fields are marked with *

0
cart-icon