Recombinant Human TRIM24 protein, GST-tagged
Cat.No. : | TRIM24-316H |
Product Overview : | Recombinant Human TRIM24(432 a.a. - 569 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 432-569 a.a. |
Description : | The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains - a RING, a B-box type 1 and a B-box type 2 - and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 40.81 kDa |
AA Sequence : | PQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPS ISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAFLAQQAIKQW |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TRIM24 tripartite motif containing 24 [ Homo sapiens ] |
Official Symbol | TRIM24 |
Synonyms | TRIM24; tripartite motif containing 24; TIF1, transcriptional intermediary factor 1 , tripartite motif containing 24; transcription intermediary factor 1-alpha; hTIF1; RNF82; TIF1A; Tif1a; TIF1-alpha; RING finger protein 82; tripartite motif-containing 24; E3 ubiquitin-protein ligase TRIM24; transcriptional intermediary factor 1; PTC6; TF1A; TIF1; TIF1ALPHA; |
Gene ID | 8805 |
mRNA Refseq | NM_015905 |
Protein Refseq | NP_056989 |
MIM | 603406 |
UniProt ID | O15164 |
Chromosome Location | 7q32-q34 |
Pathway | Regulation of Androgen receptor activity, organism-specific biosystem; |
Function | chromatin binding; estrogen response element binding; histone acetyl-lysine binding; ligand-dependent nuclear receptor binding; ligase activity; metal ion binding; NOT methylated histone residue binding; p53 binding; protein binding; protein kinase activity; receptor binding; sequence-specific DNA binding; transcription coactivator activity; ubiquitin-protein ligase activity; zinc ion binding; |
◆ Recombinant Proteins | ||
TRIM24-1546H | Recombinant Human TRIM24 Protein (891-1012 aa), His-tagged | +Inquiry |
TRIM24-335H | Recombinant Human TRIM24 Protein, Flag-tagged | +Inquiry |
TRIM24-17349M | Recombinant Mouse TRIM24 Protein | +Inquiry |
TRIM24-315H | Recombinant Human TRIM24 protein, GST-tagged | +Inquiry |
TRIM24-3409H | Recombinant Human TRIM24, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM24-789HCL | Recombinant Human TRIM24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRIM24 Products
Required fields are marked with *
My Review for All TRIM24 Products
Required fields are marked with *
0
Inquiry Basket