Recombinant Human TRIM26 protein, GST-tagged

Cat.No. : TRIM26-3662H
Product Overview : Recombinant Human TRIM26 protein(151-270 aa), fused to GST tag, was expressed in E. coli.
Availability October 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 151-270 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : NHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVISELEGKAQQPAAELMQDTRDFLNRYPRKKFW
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name TRIM26 tripartite motif containing 26 [ Homo sapiens ]
Official Symbol TRIM26
Synonyms TRIM26; tripartite motif containing 26; tripartite motif containing 26 , ZNF173; tripartite motif-containing protein 26; RNF95; acid finger protein; RING finger protein 95; zinc finger protein 173; tripartite motif-containing 26; widely expressed acid zinc finger protein; AFP; ZNF173; FLJ16483;
Gene ID 7726
mRNA Refseq NM_001242783
Protein Refseq NP_001229712
MIM 600830
UniProt ID Q12899

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRIM26 Products

Required fields are marked with *

My Review for All TRIM26 Products

Required fields are marked with *

0
cart-icon
0
compare icon