Recombinant Human TRIM26 protein, GST-tagged

• Cat.No.: TRIM26-3662H
• Product Overview: Recombinant Human TRIM26 protein(151-270 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 151-270 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: NHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVISELEGKAQQPAAELMQDTRDFLNRYPRKKFW
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TRIM26 tripartite motif containing 26 [ Homo sapiens ]
• Official Symbol: TRIM26
• Synonyms: TRIM26; tripartite motif containing 26; tripartite motif containing 26 , ZNF173; tripartite motif-containing protein 26; RNF95; acid finger protein; RING finger protein 95; zinc finger protein 173; tripartite motif-containing 26; widely expressed acid zinc finger protein; AFP; ZNF173; FLJ16483
• Gene ID: 7726
• mRNA Refseq: NM_001242783
• Protein Refseq: NP_001229712
• MIM: 600830
• UniProt ID: Q12899