Recombinant Human TRIM3 protein, GST-tagged
Cat.No. : | TRIM3-3754H |
Product Overview : | Recombinant Human TRIM3 protein(187-324 aa), fused to GST tag, was expressed in E. coli. |
Availability | July 31, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 187-324 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | SQQLQERKAEALAQISAAFEDLEQALQQRKQALVSDLETICGAKQKVLQSQLDTLRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAALAAQAFPERPHENAQLELVLEVDGLRRSVLNLGALLTTSATAHE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TRIM3 tripartite motif containing 3 [ Homo sapiens ] |
Official Symbol | TRIM3 |
Synonyms | TRIM3; tripartite motif containing 3; RNF22, tripartite motif containing 3; tripartite motif-containing protein 3; BERP; brain expressed ring finger; HAC1; ring finger protein 22; RNF97; tripartite motif protein TRIM3; RING finger protein 97; tripartite motif-containing 3; brain-expressed RING finger protein; RNF22; FLJ16135; |
Gene ID | 10612 |
mRNA Refseq | NM_001248006 |
Protein Refseq | NP_001234935 |
MIM | 605493 |
UniProt ID | O75382 |
◆ Recombinant Proteins | ||
TRIM3-4775R | Recombinant Rhesus Macaque TRIM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Trim3-6651M | Recombinant Mouse Trim3 Protein, Myc/DDK-tagged | +Inquiry |
TRIM3-6276R | Recombinant Rat TRIM3 Protein | +Inquiry |
TRIM3-3754H | Recombinant Human TRIM3 protein, GST-tagged | +Inquiry |
TRIM3-3752H | Recombinant Human TRIM3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM3-785HCL | Recombinant Human TRIM3 293 Cell Lysate | +Inquiry |
TRIM3-784HCL | Recombinant Human TRIM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIM3 Products
Required fields are marked with *
My Review for All TRIM3 Products
Required fields are marked with *