Recombinant Human TRIM3 protein, GST-tagged

• Cat.No.: TRIM3-3754H
• Product Overview: Recombinant Human TRIM3 protein(187-324 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 187-324 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: SQQLQERKAEALAQISAAFEDLEQALQQRKQALVSDLETICGAKQKVLQSQLDTLRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAALAAQAFPERPHENAQLELVLEVDGLRRSVLNLGALLTTSATAHE
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TRIM3 tripartite motif containing 3 [ Homo sapiens ]
• Official Symbol: TRIM3
• Synonyms: TRIM3; tripartite motif containing 3; RNF22, tripartite motif containing 3; tripartite motif-containing protein 3; BERP; brain expressed ring finger; HAC1; ring finger protein 22; RNF97; tripartite motif protein TRIM3; RING finger protein 97; tripartite motif-containing 3; brain-expressed RING finger protein; RNF22; FLJ16135
• Gene ID: 10612
• mRNA Refseq: NM_001248006
• Protein Refseq: NP_001234935
• MIM: 605493
• UniProt ID: O75382