Recombinant Human TRIM36 protein, GST-tagged
Cat.No. : | TRIM36-301290H |
Product Overview : | Recombinant Human TRIM36 (166-215 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Glu166-His215 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | ESTKSCMDCSASYCNECFKIHHPWGTIKAQHEYVGPTTNFRPKILMCPEH |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | TRIM36 tripartite motif containing 36 [ Homo sapiens ] |
Official Symbol | TRIM36 |
Synonyms | TRIM36; tripartite motif containing 36; E3 ubiquitin-protein ligase TRIM36; HAPRIN; RBCC728; RING finger protein 98; RNF98; tripartite motif protein 36; zinc binding protein Rbcc728; zinc-binding protein Rbcc728; tripartite motif-containing 36; tripartite motif-containing protein 36; |
Gene ID | 55521 |
mRNA Refseq | NM_001017397 |
Protein Refseq | NP_001017397 |
MIM | 609317 |
UniProt ID | Q9NQ86 |
◆ Recombinant Proteins | ||
TRIM36-301290H | Recombinant Human TRIM36 protein, GST-tagged | +Inquiry |
TRIM36-12686Z | Recombinant Zebrafish TRIM36 | +Inquiry |
TRIM36-4965R | Recombinant Rhesus monkey TRIM36 Protein, His-tagged | +Inquiry |
TRIM36-4779R | Recombinant Rhesus Macaque TRIM36 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRIM36 Products
Required fields are marked with *
My Review for All TRIM36 Products
Required fields are marked with *
0
Inquiry Basket