Recombinant Human TRIM36 protein, GST-tagged

Cat.No. : TRIM36-301290H
Product Overview : Recombinant Human TRIM36 (166-215 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Glu166-His215
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : ESTKSCMDCSASYCNECFKIHHPWGTIKAQHEYVGPTTNFRPKILMCPEH
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name TRIM36 tripartite motif containing 36 [ Homo sapiens ]
Official Symbol TRIM36
Synonyms TRIM36; tripartite motif containing 36; E3 ubiquitin-protein ligase TRIM36; HAPRIN; RBCC728; RING finger protein 98; RNF98; tripartite motif protein 36; zinc binding protein Rbcc728; zinc-binding protein Rbcc728; tripartite motif-containing 36; tripartite motif-containing protein 36;
Gene ID 55521
mRNA Refseq NM_001017397
Protein Refseq NP_001017397
MIM 609317
UniProt ID Q9NQ86

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRIM36 Products

Required fields are marked with *

My Review for All TRIM36 Products

Required fields are marked with *

0
cart-icon
0
compare icon