Recombinant Human TRIM43 protein, MBP&His-Avi-tagged, Biotinylated

Cat.No. : TRIM43-4640H
Product Overview : Biotinylated Recombinant Human TRIM43 protein(Q96BQ3)(1-446 aa), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Avi&His&MBP
Protein Length : 1-446 aa
Conjugation/Label : Biotin
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 100.0 kDa
AASequence : MDSDFSHAFQKELTCVICLNYLVDPVTICCGHSFCRPCLCLSWEEAQSPANCPACREPSPKMDFKTNILLKNLVTIARKASLWQFLSSEKQICGTHRQTKKMFCDMDKSLLCLLCSNSQEHGAHKHHPIEEAAEEHREKLLKQMRILWKKIQENQRNLYEEGRTAFLWRGNVVLRAQMIRNEYRKLHPVLHKEEKQHLERLNKEYQEIFQQLQRSWVKMDQKSKHLKEMYQELMEMCHKPDVELLQDLGDIVARSESVLLHMPQPVNPELTAGPITGLVYRLNRFRVEISFHFEVTNHNIRLFEDVRSWMFRRGPLNSDRSDYFAAWGARVFSFGKHYWELDVDNSCDWALGVCNNSWIRKNSTMVNSEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFESGSVSFLNVTKSSLIWSYPAGSLTFPVRPFFYTGHR
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name TRIM43 tripartite motif containing 43 [ Homo sapiens ]
Official Symbol TRIM43
Synonyms TRIM43; tripartite motif containing 43; tripartite motif-containing protein 43; tripartite motif-containing 43;
Gene ID 129868
mRNA Refseq NM_138800
Protein Refseq NP_620155
UniProt ID Q96BQ3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRIM43 Products

Required fields are marked with *

My Review for All TRIM43 Products

Required fields are marked with *

0
cart-icon