Recombinant Human TRIM47 protein partial ORF, GST-tagged
Cat.No. : | TRIM47-1401H |
Product Overview : | Recombinant Human TRIM47 protein partial ORF (539a.a.-638a.a.), fused to GST-tag at N-terminus, was expressed in Wheat Germ and purified by Glutathione Sepharose 4 Fast Flow. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 100 |
Description : | The protein is a E3 ubiquitin-protein ligase that mediates the ubiquitination and proteasomal degradation of CYLD. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | PLPHPFSPTVGVCLEYADRALAFYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSRLDSHFAGLFTHRLKPAFFLESVDAHLQIGPLKKSCISVLKRR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. Best use within three months from the date of receipt of this protein. |
Gene Name | TRIM47 |
Official Symbol | TRIM47 |
Synonyms | GOA; RNF100 |
Gene ID | 91107 |
mRNA Refseq | NM_033452.3 |
Protein Refseq | NP_258411.2 |
MIM | 611041 |
UniProt ID | Q96LD4 |
◆ Recombinant Proteins | ||
TRIM47-2259H | Recombinant Human TRIM47 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRIM47-10616Z | Recombinant Zebrafish TRIM47 | +Inquiry |
TRIM47-666HFL | Recombinant Full Length Human TRIM47 Protein, C-Flag-tagged | +Inquiry |
Trim47-6657M | Recombinant Mouse Trim47 Protein, Myc/DDK-tagged | +Inquiry |
TRIM47-1401H | Recombinant Human TRIM47 protein partial ORF, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM47-1829HCL | Recombinant Human TRIM47 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIM47 Products
Required fields are marked with *
My Review for All TRIM47 Products
Required fields are marked with *