Recombinant Human TRIM47 protein partial ORF, GST-tagged

Cat.No. : TRIM47-1401H
Product Overview : Recombinant Human TRIM47 protein partial ORF (539a.a.-638a.a.), fused to GST-tag at N-terminus, was expressed in Wheat Germ and purified by Glutathione Sepharose 4 Fast Flow.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 100
Description : The protein is a E3 ubiquitin-protein ligase that mediates the ubiquitination and proteasomal degradation of CYLD.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : PLPHPFSPTVGVCLEYADRALAFYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSRLDSHFAGLFTHRLKPAFFLESVDAHLQIGPLKKSCISVLKRR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. Best use within three months from the date of receipt of this protein.
Gene Name TRIM47
Official Symbol TRIM47
Synonyms GOA; RNF100
Gene ID 91107
mRNA Refseq NM_033452.3
Protein Refseq NP_258411.2
MIM 611041
UniProt ID Q96LD4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRIM47 Products

Required fields are marked with *

My Review for All TRIM47 Products

Required fields are marked with *

0
cart-icon
0
compare icon