Recombinant Human TRIM47 protein partial ORF, GST-tagged
| Cat.No. : | TRIM47-1401H |
| Product Overview : | Recombinant Human TRIM47 protein partial ORF (539a.a.-638a.a.), fused to GST-tag at N-terminus, was expressed in Wheat Germ and purified by Glutathione Sepharose 4 Fast Flow. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 100 |
| Description : | The protein is a E3 ubiquitin-protein ligase that mediates the ubiquitination and proteasomal degradation of CYLD. |
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | PLPHPFSPTVGVCLEYADRALAFYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSRLDSHFAGLFTHRLKPAFFLESVDAHLQIGPLKKSCISVLKRR |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. Best use within three months from the date of receipt of this protein. |
| Gene Name | TRIM47 |
| Official Symbol | TRIM47 |
| Synonyms | GOA; RNF100 |
| Gene ID | 91107 |
| mRNA Refseq | NM_033452.3 |
| Protein Refseq | NP_258411.2 |
| MIM | 611041 |
| UniProt ID | Q96LD4 |
| ◆ Recombinant Proteins | ||
| TRIM47-1401H | Recombinant Human TRIM47 protein partial ORF, GST-tagged | +Inquiry |
| TRIM47-3339H | Recombinant Human TRIM47 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TRIM47-6844HF | Recombinant Full Length Human TRIM47 Protein, GST-tagged | +Inquiry |
| TRIM47-2259H | Recombinant Human TRIM47 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TRIM47-666HFL | Recombinant Full Length Human TRIM47 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRIM47-1829HCL | Recombinant Human TRIM47 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIM47 Products
Required fields are marked with *
My Review for All TRIM47 Products
Required fields are marked with *



