Recombinant Human TRIM5 protein, His-tagged
Cat.No. : | TRIM5-3390H |
Product Overview : | Recombinant Human TRIM5 protein(136-224 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 136-224 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | REYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDILKSLTNSETEMVQQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TRIM5 tripartite motif containing 5 [ Homo sapiens ] |
Official Symbol | TRIM5 |
Synonyms | TRIM5; tripartite motif containing 5; tripartite motif-containing protein 5; RNF88; TRIM5alpha; tripartite motif protein TRIM; tripartite motif protein TRIM5; ring finger protein 88; tripartite motif containing 5 transcript variant iota; tripartite motif containing 5 transcript variant kappa; |
Gene ID | 85363 |
mRNA Refseq | NM_033034 |
Protein Refseq | NP_149023 |
MIM | 608487 |
UniProt ID | Q9C035 |
◆ Recombinant Proteins | ||
TRIM5-444H | Recombinant Human TRIM5 Protein, His-tagged | +Inquiry |
TRIM5-4784R | Recombinant Rhesus Macaque TRIM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRIM5-3390H | Recombinant Human TRIM5 protein, His-tagged | +Inquiry |
TRIM5-1049C | Recombinant Cynomolgus TRIM5 Protein, His-tagged | +Inquiry |
TRIM5-4970R | Recombinant Rhesus monkey TRIM5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM5-770HCL | Recombinant Human TRIM5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIM5 Products
Required fields are marked with *
My Review for All TRIM5 Products
Required fields are marked with *
0
Inquiry Basket