Recombinant Human TRIM50 protein, His-tagged
| Cat.No. : | TRIM50-6733H |
| Product Overview : | Recombinant Human TRIM50 protein(250-487 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 250-487 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | RAEMPQARPLEGAFSPISFKPGLHQADIKLTVWKRLFRKVLPAPEPLKLDPATAHPLLELSKGNTVVQCGLLAQRRASQPERFDYSTCVLASRGFSCGRHYWEVVVGSKSDWRLGVIKGTASRKGKLNRSPEHGVWLIGLKEGRVYEAFACPRVPLPVAGHPHRIGLYLHYEQGELTFFDADRPDDLRPLYTFQADFQGKLYPILDTCWHERGSNSLPMVLPPPSGPGPLSPEQPTKL |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | TRIM50 tripartite motif containing 50 [ Homo sapiens ] |
| Official Symbol | TRIM50 |
| Synonyms | TRIM50; tripartite motif containing 50; TRIM50A, tripartite motif containing 50 , tripartite motif containing 50A; E3 ubiquitin-protein ligase TRIM50; FLJ32804; E3 ubiquitin ligase; tripartite motif protein 50; tripartite motif-containing 50; tripartite motif-containing 50A; tripartite motif-containing protein 50; TRIM50A; MGC138357; MGC138359; |
| mRNA Refseq | NM_178125 |
| Protein Refseq | NP_835226 |
| MIM | 612548 |
| UniProt ID | Q86XT4 |
| Gene ID | 135892 |
| ◆ Recombinant Proteins | ||
| TRIM50-6734H | Recombinant Human TRIM50 protein, GST-tagged | +Inquiry |
| TRIM50-2652H | Recombinant Human TRIM50 Protein, MYC/DDK-tagged | +Inquiry |
| TRIM50-17379M | Recombinant Mouse TRIM50 Protein | +Inquiry |
| Trim50-6658M | Recombinant Mouse Trim50 Protein, Myc/DDK-tagged | +Inquiry |
| TRIM50-6280R | Recombinant Rat TRIM50 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIM50 Products
Required fields are marked with *
My Review for All TRIM50 Products
Required fields are marked with *




