Recombinant Human TRIM59 protein, GST-tagged

• Cat.No.: TRIM59-301346H
• Product Overview: Recombinant Human TRIM59 (128-326 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Gly128-Phe326
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: GHPIDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQGDKEAVLQYFKELNDTLEQKKKSFLTALCDVGNLINQEYTPQIERMKEIREQQLELMALTISLQEESPLKFLEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNVLIPKMKISPKRMSCSWPGKDEKEVEF
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: TRIM59 tripartite motif containing 59 [ Homo sapiens ]
• Official Symbol: TRIM59
• Synonyms: TRIM59; tripartite motif containing 59; TRIM57, tripartite motif containing 57 , tripartite motif containing 59; tripartite motif-containing protein 59; Mrf1; RNF104; TSBF1; tumor suppressor TSBF1; RING finger protein 104; tumor suppressor TSBF-1; tripartite motif-containing 57; tripartite motif-containing 59; MRF1; TRIM57; MGC26631; MGC129860; MGC129861
• Gene ID: 286827
• mRNA Refseq: NM_173084
• Protein Refseq: NP_775107
• UniProt ID: Q8IWR1