Recombinant Human TRIM63
| Cat.No. : | TRIM63-30260TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 254-352 of Human MURF1 with a proprietary tag; Predicted MWt 36.52 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 99 amino acids |
| Description : | This gene encodes a member of the RING zinc finger protein family found in striated muscle and iris. The product of this gene is localized to the Z-line and M-line lattices of myofibrils, where titins N-terminal and C-terminal regions respectively bind to the sarcomere. In vitro binding studies have shown that this protein also binds directly to titin near the region of titin containing kinase activity. Another member of this protein family binds to microtubules. Since these family members can form heterodimers, this suggests that these proteins may serve as a link between titin kinase and microtubule-dependent signal pathways in muscle. |
| Molecular Weight : | 36.520kDa inclusive of tags |
| Tissue specificity : | Muscle specific. Selectively expressed in heart and skeletal muscle. Also expressed in the iris. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | DKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQGFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEEGH |
| Sequence Similarities : | Contains 1 B box-type zinc finger.Contains 1 COS domain.Contains 1 RING-type zinc finger. |
| Gene Name | TRIM63 tripartite motif containing 63 [ Homo sapiens ] |
| Official Symbol | TRIM63 |
| Synonyms | TRIM63; tripartite motif containing 63; ring finger protein 28 , RNF28, tripartite motif containing 63; E3 ubiquitin-protein ligase TRIM63; IRF; iris ring finger protein; MURF 1; muscle specific RING finger protein 1; SMRZ; striated muscle RING zinc fing |
| Gene ID | 84676 |
| mRNA Refseq | NM_032588 |
| Protein Refseq | NP_115977 |
| MIM | 606131 |
| Uniprot ID | Q969Q1 |
| Chromosome Location | 1p34-p33 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; |
| Function | ligase activity; metal ion binding; signal transducer activity; titin binding; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| TRIM63-6283R | Recombinant Rat TRIM63 Protein | +Inquiry |
| TRIM63-4973R | Recombinant Rhesus monkey TRIM63 Protein, His-tagged | +Inquiry |
| Trim63-9833M | Recombinant Mouse Trim63 protein(1-350aa), His&Myc-tagged | +Inquiry |
| TRIM63-360Z | Recombinant Zebrafish TRIM63 | +Inquiry |
| TRIM63-4613H | Recombinant Human TRIM63 protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRIM63-1833HCL | Recombinant Human TRIM63 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIM63 Products
Required fields are marked with *
My Review for All TRIM63 Products
Required fields are marked with *
