Recombinant Human TRIM65 protein, His-tagged
Cat.No. : | TRIM65-8787H |
Product Overview : | Recombinant Human TRIM65 protein(320-517 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 320-517 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | CPLRRKLWQNYRNLTFDPVSANRHFYLSRQDQQVKHCRQSRGPGGPGSFELWQVQCAQSFQAGHHYWEVRASDHSVTLGVSYPQLPRCRLGPHTDNIGRGPCSWGLCVQEDSLQAWHNGEAQRLPGVSGRLLGMDLDLASGCLTFYSLEPQTQPLYTFHALFNQPLTPVFWLLEGRTLTLCHQPGAVFPLGPQEEVLS |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | TRIM65 tripartite motif containing 65 [ Homo sapiens ] |
Official Symbol | TRIM65 |
Synonyms | TRIM65; tripartite motif containing 65; tripartite motif-containing protein 65; 4732463G12Rik; |
mRNA Refseq | NM_001256124 |
Protein Refseq | NP_001243053 |
UniProt ID | Q6PJ69 |
Gene ID | 201292 |
◆ Recombinant Proteins | ||
TRIM65-17391M | Recombinant Mouse TRIM65 Protein | +Inquiry |
TRIM65-9619M | Recombinant Mouse TRIM65 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRIM65-8787H | Recombinant Human TRIM65 protein, His-tagged | +Inquiry |
TRIM65-8786H | Recombinant Human TRIM65 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM65-1834HCL | Recombinant Human TRIM65 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRIM65 Products
Required fields are marked with *
My Review for All TRIM65 Products
Required fields are marked with *
0
Inquiry Basket