Recombinant Human TRIP11 protein, GST-tagged

• Cat.No.: TRIP11-830H
• Product Overview: Recombinant Human TRIP11 protein(NP_004230)(1-68 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-68 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: AMSSWLGGLGSGLGQSLGQVGGSLASLTGQISNFTKDMLMEGTEEVEAELPDSRTKEIEAIHAILRSE
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
• Concentration: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TRIP11 thyroid hormone receptor interactor 11 [ Homo sapiens ]
• Official Symbol: TRIP11
• Synonyms: TRIP11; thyroid hormone receptor interactor 11; thyroid receptor-interacting protein 11; CEV14; GMAP 210; Trip230; TR-interacting protein 11; Golgi-microtubule-associated protein of 210 kDa; golgi-associated microtubule-binding protein 210; clonal evolution-related gene on chromosome 14 protein; ACG1A; TRIP-11; TRIP230; GMAP-210
• Gene ID: 9321
• mRNA Refseq: NM_004239
• Protein Refseq: NP_004230
• MIM: 604505
• UniProt ID: Q15643