Recombinant Human TRIP11 protein, GST-tagged

Cat.No. : TRIP11-830H
Product Overview : Recombinant Human TRIP11 protein(NP_004230)(1-68 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-68 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : AMSSWLGGLGSGLGQSLGQVGGSLASLTGQISNFTKDMLMEGTEEVEAELPDSRTKEIEAIHAILRSE
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
Concentration : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name TRIP11 thyroid hormone receptor interactor 11 [ Homo sapiens ]
Official Symbol TRIP11
Synonyms TRIP11; thyroid hormone receptor interactor 11; thyroid receptor-interacting protein 11; CEV14; GMAP 210; Trip230; TR-interacting protein 11; Golgi-microtubule-associated protein of 210 kDa; golgi-associated microtubule-binding protein 210; clonal evolution-related gene on chromosome 14 protein; ACG1A; TRIP-11; TRIP230; GMAP-210;
Gene ID 9321
mRNA Refseq NM_004239
Protein Refseq NP_004230
MIM 604505
UniProt ID Q15643

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRIP11 Products

Required fields are marked with *

My Review for All TRIP11 Products

Required fields are marked with *

0
cart-icon