Recombinant Human tripartite motif containing 68 Protein, GST tagged
Cat.No. : | TRIM68-13H |
Product Overview : | Human TRIM68 partial ORF (NP_060543, 181 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 181-280aa |
Description : | This gene encodes a member of the tripartite motif-containing protein family, whose members are characterized by a "really interesting new gene" (RING) finger domain, a zinc-binding B-box motif, and a coiled-coil region. Members of this family function as E3 ubiquitin ligases and are involved in a broad range of biological processes. This gene regulates the activation of nuclear receptors, such as androgen receptor, and has been implicated in development of prostate cancer cells, where its expression increases in response to a downregulation of microRNAs. In addition, this gene participates in viral defense regulation as a negative regulator of interferon-beta. Alternative splicing results in multiple transcript variants. |
Tag : | N-GST |
Molecular Mass : | 36.74 kDa |
AA Sequence : | KQSIVWEFEKYQRLLEKKQPPHRQLGAEVAAALASLQREAAETMQKLELNHSELIQQSQVLWRMIAELKERSQRPVRWMLQDIQEVLNRSKSWSLQQPEP |
Quality Control Testing : | 12.5 % SDS-PAGE Stained with Coomassie Blue. |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TRIM68 tripartite motif containing 68 [ Homo sapiens (human) ] |
Official Symbol | TRIM68 |
Synonyms | TRIM68; tripartite motif containing 68; ring finger protein 137 , RNF137, tripartite motif containing 68; E3 ubiquitin-protein ligase TRIM68; FLJ10369; SS 56; SSA protein SS-56; Ro/SSA1 related protein; ring finger protein 137; tripartite motif-containing 68; tripartite motif-containing protein 68; SS56; GC109; SS-56; RNF137; MGC126176; |
Gene ID | 55128 |
mRNA Refseq | NM_018073 |
Protein Refseq | NP_060543 |
MIM | 613184 |
UniProt ID | Q6AZZ1 |
◆ Cell & Tissue Lysates | ||
TRIM68-763HCL | Recombinant Human TRIM68 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRIM68 Products
Required fields are marked with *
My Review for All TRIM68 Products
Required fields are marked with *
0
Inquiry Basket