Recombinant Human TRMT112 Protein, GST-tagged
| Cat.No. : | TRMT112-5269H |
| Product Overview : | Human HSPC152 full-length ORF ( AAH17172, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | TRMT112 (TRNA Methyltransferase 11-2 Homolog (S. Cerevisiae)) is a Protein Coding gene. Among its related pathways are rRNA processing in the nucleus and cytosol and Gene Expression. GO annotations related to this gene include protein methyltransferase activity. |
| Molecular Mass : | 39.49 kDa |
| AA Sequence : | MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | TRMT112 tRNA methyltransferase 11-2 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | TRMT112 |
| Synonyms | TRMT112; tRNA methyltransferase 11-2 homolog (S. cerevisiae); tRNA methyltransferase 112 homolog; HSPC152; HSPC170; TRM112; TRMT11 2; TRM112-like protein; TRMT11-2; |
| Gene ID | 51504 |
| mRNA Refseq | NM_016404 |
| Protein Refseq | NP_057488 |
| UniProt ID | Q9UI30 |
| ◆ Recombinant Proteins | ||
| TRMT112-5654HF | Recombinant Full Length Human TRMT112 Protein, GST-tagged | +Inquiry |
| TRMT112-1645H | Recombinant Human TRMT112 Protein, MYC/DDK-tagged | +Inquiry |
| TRMT112-5148H | Recombinant Human TRMT112 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TRMT112-4980R | Recombinant Rhesus monkey TRMT112 Protein, His-tagged | +Inquiry |
| TRMT112-4794R | Recombinant Rhesus Macaque TRMT112 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRMT112-756HCL | Recombinant Human TRMT112 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRMT112 Products
Required fields are marked with *
My Review for All TRMT112 Products
Required fields are marked with *



