Recombinant Human TRMT13 Protein, GST-Tagged
Cat.No. : | TRMT13-0578H |
Product Overview : | Human TRMT13 full-length ORF (NP_061956.1, 1 a.a. - 481 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | TRMT13 (TRNA Methyltransferase 13 Homolog) is a Protein Coding gene. Among its related pathways are Gene Expression and tRNA processing. GO annotations related to this gene include methyltransferase activity and tRNA methyltransferase activity. |
Molecular Mass : | 80.7 kDa |
AA Sequence : | MATSATSPHAPGFPAEGRCGYYVEKKKRFCRMVVAAGKRFCGEHAGAMEEEDARKRILCPLDPKHTVYEDQLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLEKLIKKLRKASEGLNSTLKDHIMSHPALHDALNDPKNGDSATKHLKQQASILGNIENLKLLGPRRCFVEFGAGKGKLSHWVDIALKDAEKVHFILVEKVTTRFKVDGKHRKKNSVFERLQIDIQHLCLNKIPVLREEKLPVVGIGKHLCGMATDLALRCLVETYAASFEERNEEPLAKRIKNDKTEKEIYTLAKEGNEKNVPEKWNPVAGIVIALCCHHRCDWRHYVGKEYFRALGLGAVEFHYFQRMSSWATCGMRKTSLETSNSTTKRQDNQNDDSEEHDDGGYRITDDGADCLPGLLSVEEKKKIGHLCKLLIDQGRIQYLQQKGFSPALQYYTDPLVSLENVLLTALPNHSSSPETTA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TRMT13 tRNA methyltransferase 13 homolog [ Homo sapiens (human) ] |
Official Symbol | TRMT13 |
Synonyms | TRMT13; tRNA methyltransferase 13 homolog; CCDC76; coiled-coil domain containing 76; tRNA guanosine-2-O-methyltransferase TRM13 homolog; FLJ10287; FLJ11219; tRNA [Gm4] methyltransferase; coiled-coil domain-containing protein 76; |
Gene ID | 54482 |
mRNA Refseq | NM_019083 |
Protein Refseq | NP_061956 |
UniProt ID | Q9NUP7 |
◆ Recombinant Proteins | ||
TRMT13-1392H | Recombinant Human TRMT13 | +Inquiry |
TRMT13-2882HF | Recombinant Full Length Human TRMT13 Protein, GST-tagged | +Inquiry |
TRMT13-0578H | Recombinant Human TRMT13 Protein, GST-Tagged | +Inquiry |
TRMT13-4245H | Recombinant Human TRMT13 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRMT13-9638M | Recombinant Mouse TRMT13 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRMT13 Products
Required fields are marked with *
My Review for All TRMT13 Products
Required fields are marked with *