Recombinant Human TRMT44 Protein, GST-tagged
| Cat.No. : | TRMT44-5228H |
| Product Overview : | Human C4orf23 full-length ORF ( NP_689757.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a putative tRNA methyltransferase found in the cytoplasm. Defects in this gene may be a cause of partial epilepsy with pericentral spikes (PEPS), but that has not been proven definitively. [provided by RefSeq, May 2012] |
| Molecular Mass : | 67.7 kDa |
| AA Sequence : | MYGPQTQLEEDAITPNDKTLFPDVDWLIGNHSDELTPWIPVIAARSSYNCRFFVLPCCFFDFIGRYSRRQSKKTQYREYLDFIKEVGFTCGFHVDEDCLRIPSTKRVCLVGKSRTYPSSREASVDEKRTQYIKSRRGCPVSPPGWELSPSPRWVAAGSAGHCDGQQALDARVGCVTRAWAAEHGAGPQAEGPWLPGFHPREKAERVRNCAALPRDFIDQVVLQVANLLLGGKQLNTRSSRNGSLKTWNGGESLSLAEVANELDTETLRRLKRECGGLQTLLRNSHQVFQVVNGRVHIRDWREETLWKTKQPEAKQRLLSEACKTRLCWFFMHHPDGCALSTDCCPFAHGPAELRPPRTTPRKKIS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | TRMT44 tRNA methyltransferase 44 homolog [ Homo sapiens (human) ] |
| Official Symbol | TRMT44 |
| Synonyms | TRNA Methyltransferase 44 Homolog (S. Cerevisiae); Methyltransferase-Like Protein 19; Methyltransferase Like 19; C4orf23; METTL19; Probable TRNA (Uracil-O(2)-)-Methyltransferase; Chromosome 4 Open Reading Frame 23; EC 2.1.1.211; EC 2.1.1; TRM44; TRMT44; tRNA methyltransferase 44 homolog; probable tRNA (uracil-O(2)-)-methyltransferase; methyltransferase like 19; methyltransferase-like protein 19 |
| Gene ID | 152992 |
| mRNA Refseq | NM_001350233 |
| Protein Refseq | NP_001337162 |
| MIM | 614309 |
| UniProt ID | Q8IYL2 |
| ◆ Recombinant Proteins | ||
| TRMT44-1221H | Recombinant Human TRMT44 | +Inquiry |
| TRMT44-4246H | Recombinant Human TRMT44 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TRMT44-5228H | Recombinant Human TRMT44 Protein, GST-tagged | +Inquiry |
| TRMT44-1593Z | Recombinant Zebrafish TRMT44 | +Inquiry |
| TRMT44-3863HF | Recombinant Full Length Human TRMT44 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRMT44 Products
Required fields are marked with *
My Review for All TRMT44 Products
Required fields are marked with *



